ESTScan Details for Unigene SGN-U291356

Score 
462
Direction 
Forward
Predicted Peptide Sequence 
PNAAVRYAHIFPHVDIMFCTIILEFGKKGDLASALTVFEASKQNQDTPNLYIYRTAIDVCGLCGDYLKSRSIYEGLIASKFTPNIYVFNS
LMNVNACDLSYTLDIYKQMQKLGVPADLTSYNILLKSCCLATRVDLAKEIYGELKHLEMAGALKLDVFTYSTLIKVFADAKMWQMALEIK
KDMLSAGVTPNIVTWSSLISACANAGLVDQAIQLFEEMLQAGCEPNFNVXTFFLMHVLKPANM
Predicted Coding Sequence 
XXGCCAAATGCAGCAGTAAGGTATGCACATATCTTTCCACATGTGGACATTATGTTCTGTACCATAATTCTTGAATTTGGGAAGAAAGGC
GATTTGGCGTCTGCTCTAACTGTCTTTGAAGCATCCAAGCAGAACCAGGACACCCCGAATTTGTATATTTACCGCACAGCAATAGATGTT
TGTGGTCTTTGTGGTGACTACTTGAAGTCCAGGTCCATATATGAGGGGTTAATAGCTAGCAAGTTTACACCAAACATTTATGTCTTCAAC
AGCCTCATGAATGTAAATGCATGTGACTTGAGTTACACCTTGGACATATACAAGCAAATGCAAAAACTAGGTGTTCCAGCTGACTTGACA
TCTTACAATATTCTTCTGAAGTCATGTTGTCTTGCTACAAGAGTTGATCTGGCCAAAGAAATTTATGGGGAGCTAAAGCATTTAGAAATG
GCAGGAGCATTGAAATTGGATGTCTTCACGTACAGCACTTTAATTAAGGTATTTGCAGATGCAAAAATGTGGCAGATGGCACTTGAAATA
AAAAAAGATATGCTATCAGCTGGTGTCACTCCCAACATTGTCACTTGGTCTTCATTGATCAGTGCCTGTGCCAATGCAGGCCTGGTAGAC
CAAGCTATTCAGTTATTTGAAGAGATGCTTCAGGCTGGTTGTGAACCTAATTTCAATGTTANCACATTCTTTCTCATGCATGTGTTGAAG
CCTGCCAATATG\
Edits in Original Sequence 
(5')XXGCCAAATGCAGCAGTAAGGTATGCACATATCTTTCCACATGTGGACATTATGTTCTGTACCATAATTCTTGAATTTGGGAAGAA
AGGCGATTTGGCGTCTGCTCTAACTGTCTTTGAAGCATCCAAGCAGAACCAGGACACCCCGAATTTGTATATTTACCGCACAGCAATAGA
TGTTTGTGGTCTTTGTGGTGACTACTTGAAGTCCAGGTCCATATATGAGGGGTTAATAGCTAGCAAGTTTACACCAAACATTTATGTCTT
CAACAGCCTCATGAATGTAAATGCATGTGACTTGAGTTACACCTTGGACATATACAAGCAAATGCAAAAACTAGGTGTTCCAGCTGACTT
GACATCTTACAATATTCTTCTGAAGTCATGTTGTCTTGCTACAAGAGTTGATCTGGCCAAAGAAATTTATGGGGAGCTAAAGCATTTAGA
AATGGCAGGAGCATTGAAATTGGATGTCTTCACGTACAGCACTTTAATTAAGGTATTTGCAGATGCAAAAATGTGGCAGATGGCACTTGA
AATAAAAAAAGATATGCTATCAGCTGGTGTCACTCCCAACATTGTCACTTGGTCTTCATTGATCAGTGCCTGTGCCAATGCAGGCCTGGT
AGACCAAGCTATTCAGTTATTTGAAGAGATGCTTCAGGCTGGTTGTGAACCTAATTTCAcATGTTANCACATTCTTTCTCATGCATGTGT
TGAAGCCTGCCAATATG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan