ESTScan Details for Unigene SGN-U291437

Score 
130
Direction 
Forward
Predicted Peptide Sequence 
VKLSDGHLVEPPTFFVGRPLSLLSPNQTQSTTQDGDFNRAKSLFNEAIGKGMESNIILYNTLIKGMCQQGLILEALRLITEMPEKSCRPN
TWTYNLIINGLCKMGCVSDASNILNDAVPKGILPDIFTFNTLIDGYCKQSKLADAIEILNTMWHHDVVPDVITYNTMLNGLCKLKTSDDV
M
Predicted Coding Sequence 
GTAAAACTCAGTGACGGGCACTTGGTTGAGCCGCCAACATTTTTCGTCGGCCGCCCTCTTTCTCTGTTGTCACCGAACCAAACCCAGTCA
ACGACTCAGGATGGTGACTTCAACAGAGCCAAGAGTTTATTTAATGAAGCCATAGGTAAAGGTATGGAGTCTAATATAATACTCTATAAC
ACCTTAATTAAGGGAATGTGTCAGCAGGGACTTATCTTAGAAGCATTGAGATTGATTACTGAAATGCCTGAGAAAAGTTGCAGGCCTAAT
ACATGGACATATAATCTGATCATCAATGGGTTGTGCAAGATGGGTTGTGTATCTGATGCTAGTAATATCCTGAATGATGCCGTGCCCAAA
GGGATCCTTCCTGATATTTTTACCTTCAACACCTTGATTGATGGTTATTGCAAACAGTCAAAATTGGCTGATGCAATCGAGATTCTAAAT
ACAATGTGGCATCATGATGTTGTTCCTGATGTGATAACCTATAACACCATGTTGAATGGACTTTGCAAGCTTAAAACTTCTGATGATGTG
ATG\
Edits in Original Sequence 
(5')GTAAAACTCAGTGACGGGCACTTGGTTGAGCCGCCAACATTTTTCGTCGGCCGCCCTCTTTCTCTGTTGTCACCGAACCAAACCCA
GTCAACGACTCAGGATGGTGACTTCAACAGAGCCAAGAGTTTATTTAATGAAGCCATAGGTAAAGGTATGGAGTCTAATATAATACTCTA
TAACACCTTAATTAAGGGAATGTGTCAGCAGGGACTTATCTTAGAAGCATTGAGATTGATTACTGAAATGCCTGAGAAAAGTTGCAGGCC
TAATACATGGACATATAATCTGATCATCAATGGGTTGTGCAAGATGGGTTGTGTATCTGATGCTAGTAATATCCTGAATGATGCCGTGCC
CAAAGGGATCCTTCCTGATATTTTTACCTTCAACACCTTGATTGATGGTTATTGCAAACAGTCAAAATTGGCTGATGCAATCGAGATTCT
AAATACAATGTGGCATCATGATGTTGTTCCTGATGTGATAACCTATAACACCATGTTGAATGGACTTTGCAAGCTTAAAACTTCTGATGA
TGTGATG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan