ESTScan Details for Unigene SGN-U291502

Score 
139
Direction 
Forward
Predicted Peptide Sequence 
MFDCGSKSQYVGGEREKFVRLDDLDSRLSSPSASLTANTCGFNIEGLKRSSHALAVRRGLLREEXKKGSEGLKSIGRSLGFGVSRAVFPE
DLKVSEKKIFDPQDKFLLLW
Predicted Coding Sequence 
ATGTTCGACTGTGGTTCCAAGTCCCAATATGTTGGGGGGGAGCGAGAGAAGTTTGTAAGGTTGGATGACTTGGATTCCAGACTATCCTCT
CCTTCTGCATCACTTACAGCAAATACATGTGGCTTCAACATTGAGGGTTTAAAACGTTCAAGCCATGCACTAGCAGTCCGTCGAGGTCTT
TTAAGAGAGGAGXTGAAAAAAGGATCCGAAGGACTTAAATCAATTGGTCGATCACTGGGATTTGGCGTCTCTCGGGCTGTATTTCCTGAA
GATCTGAAAGTTTCAGAGAAGAAGATTTTTGACCCTCAAGATAAATTCCTTCTATTATGG\
Edits in Original Sequence 
CTTTGTTCCCTTCTTAACCCCACCACCCCACACAAACACCTCACTATTTTCTTCATCATCTTCATGTCTATTTTCAAGAATTAATTTTTT
AAGACTTCCAACTTGACTGTATATGTGTTTGACAGTACAAG
(5')ATGTTCGACTGTGGTTCCAAGTCCCAATATGTTGGGGGGGAGCGA
GAGAAGTTTGTAAGGTTGGATGACTTGGATTCCAGACTATCCTCTCCTTCTGCATCACTTACAGCAAATACATGTGGCTTCAACATTGAG
GGTTTAAAACGTTCAAGCCATGCgACTAGCAGTCCGTCGAGGTCTTTTAAGAGAGGAGXTGAAAAAAGGATCCGAAGGACTTAAATCAAT
TGGTCGATCACTGGGATTTGGCGTCTCTCGGGCTGTATTTCCTGAAGATCTGAAAGTTTCAGAGAAGAAGATTTTTGACCCTCAAGATAA
ATTCCTTCTATTATGG\(3')AACAAACTGTTTGTTGTATCATGTATTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan