ESTScan Details for Unigene SGN-U291643

Score 
429
Direction 
Forward
Predicted Peptide Sequence 
RGLAVSATNQVPPPRPETESFREMAKRAENEQPQKAFGWAARDPSGILSPFHFSRRENGDDDVXSEDTIIVEYVTQTLHSLKNEWGFTKY
PILPGHEIVGFVTAVGSSVHKFKVGDRVGVGVIEAPVKHVTSVNRAWRTIVPTVIFTYNSTDHDGTNTYGGYSDMIVVHQRFVLQFPENL
PSDAGAPLLCAGITVX
Predicted Coding Sequence 
CGAGGATTAGCAGTTAGTGCTACCAACCAAGTTCCTCCACCAAGACCAGAGACAGAGAGCTTTAGAGAAATGGCGAAAAGAGCAGAGAAT
GAGCAGCCACAAAAAGCATTTGGCTGGGCAGCCAGGGACCCCTCCGGAATCCTCTCTCCCTTCCATTTCTCCCGCAGAGAAAATGGTGAT
GATGATGTCAXCAGTGAAGATACCATTATTGTGGAATATGTCACTCAGACCTTGCATTCTTTGAAGAATGAATGGGGATTCACAAAATAC
CCCATTCTCCCTGGGCATGAAATTGTTGGTTTCGTGACAGCCGTTGGCAGTAGTGTCCATAAGTTCAAGGTTGGTGACAGAGTTGGAGTT
GGGGTGATTGAGGCTCCTGTCAAACATGTGACATCTGTGAACAGAGCTTGGAGAACTATTGTCCCAACXGTGATATTTACCTACAACTCC
ACTGACCATGATGGTACAAATACCTATGGCGGTTACTCTGATATGATAGTTGTTCATCAGCGCTTTGTTCTTCAATTTCCTGAAAATCTA
CCTTCTGATGCTGGGGCACCTTTATTATGTGCTGGAATCACTGTGTXX\
Edits in Original Sequence 
(5')CGAGGATTAGCAGTTAGTGCTACCAACCAAGTTCCTCCACCAcAGACCAGAGACAGAGAGCTTTAGAGAAATGGCGAAAAGAGCAG
AGAATGAGCAGCCACAAAAAGCATTTGGCTGGGCAGCCAGGGACCCCTCCGGAATCCTCTCTCCCTTCCATTTCTCCCGCAGAGAAAATG
GTGATGATGATGTCAXCAGTGAAGATACCATTATTGTGGAATATGTCACTCAGACCTTGCATTCTTTGAAGAATGAATGGGGATTCACAA
AATACCCCATTCTCCCTGGGCATGAAATTGTTGGTTTCGTGACAGCCGTTGGCAGTAGTGTCCATAAGTTCAAGGTTGGTGACAGAGTTG
GAGTTGGGGTGATTGtAGGCTCCTGTCAAACATGTGACATCTGTGAACAGAGCTTGGAGAACTATTGTCCCAACXGTGATATTTACCTAC
AACTCCACTGACCATGATGGTACAAATACCTATGGCGGTTACTCTGATATGATAGTTGTTCATCAGCGCTTTGTTCTTCAATTTCCTGAA
AATCTACCTTCTGATGCTGGGGCACCTTTATTATGTGCTGGAATCACTGTGTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan