Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U291799

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
ILEDMSNNSFLPVIPVYRLLIDSYQKAGRLEFAVELLKEISSSSPFPHLDKKMYSSLIECLSVSNKIDLAFELYVDMTKKGAVPELTDFV
NLIKGLISMNKWENALELSESLYYMLHASKSTNIQLLXEVENDALRLSHPEALPAGTXIYILGAX
Predicted Coding Sequence 
XGTATATTAGAAGACATGAGCAACAACAGTTTTCTTCCGGTTATTCCAGTTTATAGGCTTCTAATTGATAGCTATCAAAAAGCTGGAAGA
CTTGAATTTGCCGTTGAGCTACTTAAAGAGATTTCATCATCTTCACCATTTCCGCATCTTGATAAGAAAATGTACTCTTCTTTGATCGAG
TGCCTTTCTGTTTCAAACAAAATTGATCTGGCATTTGAATTATATGTGGACATGACAAAGAAAGGTGCAGTTCCAGAGCTGACGGACTTT
GTTAACCTCATCAAGGGTTTAATAAGTATGAATAAATGGGAGAATGCACTTGAACTCTCTGAGAGCTTGTATTACATGTTACATGCATCG
AAATCCACCAATATTCAGCTCCTTXTAGAGGTCGAGAATGATGCATTGAGACTATCTCATCCTGAGGCACTACCTGCTGGCACCXTGATA
TACATTCTTGGAGCTGXX\
Edits in Original Sequence 
(5')XGTATATTAGAAGACATGAGCAACAACAGTTTTCTTCCGGTTATTCCAGTTTATAGGCTTCTAATTGATAGCTATCAAAAAGCTGG
AAGACTTGAATTTGCCGTTGAGCTACTTAAAGAGATTTCATCATCTTCACCATTTCCGCATCTTGATAAGAAAATGTACTCTTCTTTGAT
CGAGTGCCTTTCTGTTTCAAACAAAATTGATCTGGCATTTGAATTATATGTGGACATGACAAAGAAAGGTGCAGTTCCAGAGCTGACGGA
CTTTGTTAACCTCATCAAGGGTTTAATAAGTATGAATAAATGGGAGAATGCACTTGAACTCTCTGAGAGCTTGTATTACATGTTACATGC
ATCGAAATCCACCAATATTCAGCTCCTTXTAGAGGTCGAGAtATGATGCATTGAGACTATCTCATCCTGAGGCACTACCTGCTGGCACCX
TGATATACATTCTTGGAGCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan