ESTScan Details for Unigene SGN-U291890

Score 
520
Direction 
Forward
Predicted Peptide Sequence 
MTHWRDLQKLKRRPLTIPSKGNWNWLILLRLSQSEPLRCVSTPXDLLLQYLHKTESITMLGIINERINFQVSPGSPGSISDDAEVVTLVA
KWPDASLINQKEVHWGLLEDSLEERLEKTGGSVPDSEKFDGDPKEGEVEENKKKSVEGGKQGAPLKKLKKDKVGVATGKPSRTESSTVTT
APRVKPELALPAIPVEVELSILGGLEEPCTVE
Predicted Coding Sequence 
ATGACGCATTGGCGTGATCTTCAGAAGTTAAAAAGGCGTCCTCTCACCATCCCATCTAAAGGAAATTGGAATTGGCTCATTCTATTACGG
CTGAGCCAAAGTGAACCATTAAGATGTGTCAGTACTCCTXATGATCTTTTGCTGCAATACTTGCACAAGACAGAATCTATTACAATGCTG
GGGATCATCAATGAGCGCATTAATTTTCAAGTTTCTCCTGGAAGCCCTGGCTCTATATCTGATGATGCGGAAGTTGTAACTCTTGTTGCA
AAGTGGCCTGATGCTAGTCTCATAAATCAGAAAGAAGTTCATTGGGGGCTGCTTGAAGATTCTTTAGAAGAACGGTTAGAAAAGACAGGA
GGTTCGGTTCCAGACTCAGAAAAGTTTGACGGAGATCCTAAGGAAGGAGAAGTGGAAGAAAACAAGAAGAAGTCAGTTGAAGGTGGTAAA
CAAGGTGCACCTCTTAAAAAACTAAAGAAGGACAAAGTTGGGGTTGCAACAGGGAAACCTTCTCGTACAGAGAGTAGCACGGTGACAACT
GCACCACGTGTCAAACCGGAACTTGCTTTACCTGCTATACCTGTAGAGGTAGAACTTTCTATTCTGGGAGGACTTGAGGAACCGTGTACA
GTTGAGTAA\
Edits in Original Sequence 
ATTTATTCATTGTTTCATGGAACTTGTCGCTAGAGGTCATATCAAGAAGCACGAGCCCTTTTCAATAGTAACCGTGAAAGAACATGAG(5')
ATGACGCATTGGCGTGATCTTCAGAAGTTAAAAAGGCGTCCTCTCACCATCCCATCTAAAGGAAATTGGAATTGGCTCATTCTATTAC
GGCTGAGCCAAAGTGAACCATTAAGATGTGTCAGTACTCCTXATGATCTTTTGCTGCAATACTTGCACAAGACAGAATCTATTACAATGC
TGGGGATCATCAATGAGCGCATTAATTTTCAAGTTTCTCCTGGAcAGCCCTGGCTCTATATCTGATGATGCGGAAGTTGTAACTCTTGTT
GCAAAGTGGCCaTGATGCTAGTCTCATAAATCAGAAAGAAGTTCATTGGGGGCTGCTTGAAGATTCTTTAGAAGAACGGTTAGAAAAGAC
AGGAGGTTCGGTTCCAGACTCAGAAAAGTTTGACGGAGATCCTAAGGAAGGAGAAGTGGAAGAAAACAAGAAGAAGTCAGTTGAAGGTGG
TAAACAAGGTGCACCTCTTAAAAAACTAAAGAAGGACAAAGTTGGGGTTGCAACAGGGAAACCTTCTCGTACAGAGAGTAGCACGGTGAC
AACTGCACCACGTGTCAAACCGGAACTTGCTTTACCTGCTATACCTGTAGAGGTAGAACTTTCTATTCTGGGAGGACTTGAGGAACCGTG
TACAGTTGAGTAA\(3')TGCATCATTGCCCTCAGTTAGCTTCTATACATTTGTTCAATACACACTAATGGACTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan