ESTScan Details for Unigene SGN-U291929

Score 
362
Direction 
Forward
Predicted Peptide Sequence 
MAVAYPQFFGTKKVDTSLMVSSSSSVSPVILSQDELKKVAAYKAVEFVESGMVXGFRVQGLQQSMLLTKIAELLHSGTLRTIVGIPTSKI
THEQAVSLGNPRLSDLNKAPIXDLAIDGADEVDPSNEFGKRGEEGHCFRGKKWV
Predicted Coding Sequence 
ATGGCTGTTGCATACCCTCAATTTTTTGGTACAAAAAAAGTTGACACTTCATTGATGGTGTCATCATCTTCCTCTGTTTCCCCTGTTATT
CTATCTCAAGATGAGTTGAAAAAGGTAGCTGCTTATAAAGCTGTGGAGTTTGTTGAGTCTGGTATGGTTGXTGGGTTTAGGGTACAGGGT
CTACAGCAAAGCATGCTGTTGACCAAAATAGCTGAGCTTTTACATAGTGGTACGTTAAGAACCATTGTAGGGATTCCCACTTCAAAGATT
ACTCATGAACAAGCTGTTTCACTTGGTAATCCXCGTTTATCAGATCTGAATAAAGCACCTATTGXTGATTTAGCAATTGATGGTGCTGAT
GAAGTTGACCCTTCAAATGAATTTGGTAAAAGGGGAGAGGAGGGTCATTGCTTTAGGGGAAAAAAATGGGTT\
Edits in Original Sequence 
CATTATCTTCTCCCCCTCCACAAATTCCAATCTTGATAATAATTTTTTTTTCAAAATAAAGAAAACCCCTTTATCCAGATTCCTCCAATT
CTTGATTTTCATCCATATATATACCTCTAATGGTTTCATTCTTCATTATACCTCCAACCCCTTTTAACAATTTTATGCTAAAGATTCAAT
CTTTATCTTGAATTCTTGATTTTCCCTCAATCTTTGTGTTGTTAAGCA
(5')ATGGCTGTTGCATACCCTCAATTTTTTGGTACAAAAAA
AGTTGACACTTCATTGATGGTGTCATCATCTTCCTCTGTTTCCCCTGTTATTCTATCTCAAGATGAGTTGAAAAAGGTAGCTGCTTATAA
AGCTGTGGAGTTTGTTGAGTCTGGTATGGTTGXTGGGTTTAGGGTACAGGGTCTACAGCAAAGCATGCTGTTGACCAAAATAGCTGAGCT
TTTACATAGTGGTACGTTaAAGAACCATTGTAGGGATTCCCACTTCAAAcGATTACTCATGAACAAGCTGTTTCACTTGGTAATCCXCGT
TTATCAGATCTGAATAAAGCACCTATTGXTGATTTAGCAATTGATGGTGCTGATGAAGTTGACCCTTCAAATGAATTTGGTAAAAGGGGA
GAGGAGGGTCATTGCTTTAGGGGAAAAAAATGGGTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan