ESTScan Details for Unigene SGN-U291931

Score 
299
Direction 
Reverse
Predicted Peptide Sequence 
RATVRAVISIVTAKQWKFYQIDVYNVFLQGNLYEEVYMTVLEGFCDKGGKNAQXLQAIEVVILLKASFQAMEYQAYCSLDIIMFSPEHKR
LFFVHKEGGDKTAIILVYVDDLLLTRDDHAXDSYATESKIKDALQTTFKIKDMRELRYFLGIEFXQKQGWDFDAPKKI
Predicted Coding Sequence 
AGGGCCACAGTCAGAGCAGTCATTTCAATTGTTACAGCTAAGCAATGGAAGTTCTACCAAATTGATGTTTACAATGTCTTCTTGCAAGGG
AACTTGTATGAAGAAGTGTACATGACTGTCTTAGAAGGTTTTTGTGACAAGGGTGGCAAAAATGCACAAGXTTTGCAGGCTATTGAAGTC
GTAATATTGCTTAAAGCAAGCTTCCAGGCAATGGAATATCAAGCTTACTGCAGTCTTGACATCATAATGTTTTCACCAGAGCACAAGAGA
CTATTCTTTGTTCACAAAGAGGGAGGTGACAAAACTGCCATAATTTTGGTGTATGTAGATGACTTGTTACTGACAAGGGATGATCATGCC
AXGGACTCCTATGCCACAGAATCGAAAATTAAGGACGCTTTACAAACAACTTTCAAGATCAAGGATATGAGAGAGCTCAGATACTTTCTT
GGCATTGAATTTGXTCAAAAGCAAGGATGGGATTTTGATGCACCAAAGAAAATATGA\
Edits in Original Sequence 
GCTTCCATTAGTTAGTTGTTTAGTGGTTAGGGAGCTAATTATTTCATAATTGTAATTAGTTGTTAGGCTAAATTACCAAGAAACCTTATC
ACCAGCGGTCAAA
(5')AGGGCCACAGTCAGAGCAGTCATTTCAATTGTTACAGCTAAGCAATGGAAGTTCTACCAAATTGATGTTTACA
ATGTCTTCTTGCAAGGGAACTTGTATGAAGAAGTGTACATGACTGTCTTAGAAGGTTTTTGTGACAAGGGTGGCAAAAATGCACAAGXTT
TGCAGGCTATTGAAGTCGTAATATTGCTTAAAGCAAGCTTCCAGGCAATGGAATATCAAGCTTACTGCAGTCTTGACATCATAATGTTTT
CACCAGAGCACAAGAGACTATTCTTTGTTCACAAAGAGGGAgGGTGACAAAACTGCCATAATTTTGGTGTATGTAGATGACTTGTTACTG
ACAAGGGATGATCATGCCAXGGACTCCTATGCCACAGAATCGAAAATTAAGGACGCTTTACAAACAACTTTCAAGATCAAGGATATGAGA
GAGCTCAGATACTTTCTTGGCATTGAATTTGXTCAAAAGCAAGGATGGGATTTTGATGCACCAAAGAAAATATGA\(3')TTTGGAGTTA
GT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan