ESTScan Details for Unigene SGN-U292031

Score 
557
Direction 
Reverse
Predicted Peptide Sequence 
FQTVSGEILMGFSKDVTKLAAPCLNYCPEGLDLDRCHRNDMDCAKGLSVLSNYYPSCPQPELTMGTIQHSDGDFFTVLLQDEIGGLQVLH
QNQWVNVPPIPGALIVNIGDFLQLMSNDKYLSVEHRVIANKDVSRMSVACFFGDNVQSSKLYGPITELLSEDNPPKYRATTLKDYRSYIY
NKGIDGTSALLRYKI
Predicted Coding Sequence 
TTCCAAACAGTATCCGGGGAAATACTAATGGGATTTTCCAAGGATGTGACGAAATTGGCTGCTCCTTGCTTGAATTATTGTCCTGAAGGT
CTCGATCTTGATCGTTGTCATCGCAATGATATGGATTGTGCTAAAGGGCTTAGTGTTTTGAGCAATTACTATCCATCATGCCCTCAGCCC
GAACTCACCATGGGCACCATACAACATTCCGATGGTGATTTTTTCACAGTTCTTCTACAAGATGAAATCGGAGGACTCCAAGTTCTTCAT
CAGAATCAATGGGTTAATGTTCCTCCTATACCTGGTGCTCTCATCGTTAACATTGGAGATTTTCTTCAGCTCATGTCAAATGACAAGTAC
CTAAGTGTTGAACACAGAGTAATTGCAAATAAAGATGTGTCAAGAATGTCAGTTGCCTGCTTCTTTGGTGATAATGTGCAATCTTCCAAG
CTTTATGGACCAATTACTGAATTATTATCAGAAGATAATCCTCCAAAATATCGCGCAACCACATTGAAAGACTACAGGAGTTACATCTAT
AATAAAGGCATAGATGGAACTTCTGCATTGTTGCGTTACAAGATATAA\
Edits in Original Sequence 
(5')TTCCAAACAGTATCCGGGGAAATACTAATGGGATTTcTCCAAGGATGTGACGAAATTGGCTGCTCCTTGCTTGAATTATTGTCCTG
AAGGTCTCGATCTTGATCGTTGTCATCGCAATGATATGGATTGTGCTAAAGGGCTTAGTGTTTTGAGCAATTACTATCCATCATGCCCTC
AGCCCGAACTCACCATGGGCACCATACAACATTCCGATGGTGATTTTTTCACAGTTCTTCTACAAGATGAAATCGGAGGACTCCAAGTTC
TTCATCAGAATCAATGGGTTAATGTTCCTCCTATACCTGGTGCTCTCATCGTTAACATTGGAGATTTTCTTCAGCTCATGTCAAATGACA
AGTACCTAAGTGTTGAACACAGAGTAATTGCAAATAAAGATGTGTCAAGAATGTCAGTTGCCTGCTTCTTTGGTGATAATGTGCAATCTT
CCAAGCTTTATGGACCAATTACTGAATTATTATCAGAAGATAATCCTCCAAAATATCGCGCAACCACATTGAAAGACTACAGGAGTTACA
TCTATAATAAAGGCATAGATGGAACTTCTGCATTGTTGCGTTACAAGATATAA\(3')TAATGTATATTATTACTATTCCTTTTCGTTCT
AGCTATTTGTCGTGTTCATTTCATACTTCTGCAGATTGTACTTTTGAATTTGAAGTGTTGTTTTTTGTATTAGTGAGACAATGTTTAACC
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan