ESTScan Details for Unigene SGN-U292055

Score 
316
Direction 
Forward
Predicted Peptide Sequence 
EDFSAAIAMAIPFISSISGSAFTIRAYSSCRYSKKSISVMDKFGVNSSNLDDAVTLFHQMVTMKPLPSVVHFSQLFKTMIKMKHYSGALS
LFRQMLKLGIPISDFILNIMINSYCLMYRVDCAFSVLPIYLKNGIPFNTVTFNTLLKGIFAQNKVKDAVELFKKLVRDKDLWPDEVMYAI
X
Predicted Coding Sequence 
GAGGATTTCTCTGCXGCAATTGCAATGGCTATTCCCTTTATCTCTTCCATTTCTGGTTCGGCATTTACAATTAGAGCTTATTCTTCATGC
CGTTACAGTAAAAAATCCATTTCAGTAATGGATAAATTTGGTGTAAATAGTAGCAATTTAGATGATGCTGTTACTCTCTTCCATCAAATG
GTTACAATGAAGCCTCTTCCTTCAGTTGTCCATTTCTCTCAATTGTTTAAGACTATGATAAAGATGAAACATTACTCTGGTGCCCTTTCT
CTTTTTCGACAAATGCTGAAATTGGGCATCCCAATTAGTGATTTCATCTTAAATATCATGATTAATAGTTATTGCCTGATGTATCGGGTT
GATTGTGCATTTTCGGTGTTACCCATTTACTTGAAGAATGGCATTCCATTTAATACTGTTACCTTTAACACCCTATTAAAAGGAATCTTT
GCTCAAAATAAGGTCAAAGATGCAGTTGAATTGTTCAAGAAGTTGGTGAGAGACAAAGATTTGTGGCCTGACGAAGTCATGTATGCAATC
GXX\
Edits in Original Sequence 
(5')GAGGATTTCTCTGCXGCAATTGCAATGGCTATTCCCTTTATCTCTTCCATTTCTGGTTCGGCATTTACAATTAGAGCTTATTCTTC
ATGCCGTTACAGTAAAAAATCCATTTCAGTAATGGATAAATTTGGTGTAAATAGTAGCAATTTAGATGATGCTGTTACTCTCTTCCATCA
AATGGTTACAATGAAGCCTCTTCCTTCAGTTGTCCATTTCTCTCAATTGTTTAAGACTATGATAAAGATGAAACATTACTCTGGTGCCCT
TTCTCTTTTTCGACAAATGCTGAAATTGGGCATCCCAATTAGTGATTTCATCTTAAATATCATGATTAATAGTTATTGCCTGATGTATCG
GGTTGATTGTGCATTTTCGGTGTTACCCATTTACTTGAAGAATGGCATTCCATTTAATACTGTTACCTTTAACACCCTATTAAAAGGAAT
CTTTGCTCAAAATAAGGTCAAAGATGCAGTTGAATTGTTCAAGAAGTTGGTGAGAGACAAAGATTTGTGaGCCTGACGAAGTCATGTATG
CAATCGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan