ESTScan Details for Unigene SGN-U292061

Score 
110
Direction 
Forward
Predicted Peptide Sequence 
QDQDRISAIAQCRADVELQACRDCINNATRLILEKCPSKKSAFEVYDVCLIRYSNESFIGTMSTDPQSIYYYNRDFSDPQLFFNQYLPPV
LTSLRTRASAGGKHKFAANVFRAPDFQTIHALVQCTTDLSARGCYDCLTAIYSSLPGCGVKXGETTIXCPAALFGXEPYSFFNESLLAEA
PPPL
Predicted Coding Sequence 
XXCCAAGATCAGGACAGGATTAGTGCCATCGCACAATGTAGAGCAGATGTTGAATTACAAGCATGCCGTGACTGTATAAATAATGCTACT
CGCTTGATTTTAGAGAAATGCCCTTCCAAGAAATCAGCCTTTGAGGTTTATGATGTGTGTCTGATAAGATATTCAAATGAGTCCTTCATA
GGCACCATGTCAACCGACCCACAATCTATTTATTATTACAACAGGGATTTCTCGGACCCCCAATTGTTTTTTAACCAATATCTGCCACCC
GTGTTGACAAGCTTACGAACTCGAGCTTCAGCGGGTGGAAAACACAAGTTTGCTGCTAATGTTTTTAGAGCCCCTGATTTTCAGACTATA
CATGCACTTGTACAGTGCACAACCGACTTATCAGCTCGAGGTTGCTATGATTGTTTAACCGCTATTTATTCAAGTTTGCCTGGCTGTGGT
GTTAAAGXTGGGGAAACTACTATATAATGCCCAGCTGCATTGTTCGGTXATGAACCTTACTCATTCTTCAACGAATCATTATTGGCTGAA
GCTCCACCACCCTTA\
Edits in Original Sequence 
(5')XXCCAAGATCAGGACAGGATTAGTGCCATCGCACAATGTAGAGCAGATGTTGAATTACAAGCATGCCGTGACTGTATAAATAATGC
TACTCGCTTGATTTTAGAGAAATGCCCTTCCAAGAAATCAGCCTTTGAGGTTTATGATGTGTGTCTGATAAGATATTCAAATGAGTCCTT
CATAGGCACCATGTCAACCGACCCACAATCTATTTATTATTACAACAGGGATTTCTCGGACCCCCAATTGTTTTTTAACCAATATCTGCC
ACCCGTGTTGACAAGCTTACGAACTCGAGCTTCAGCGGGTGGAAAACACAAGTTTGCTGCTAATGTTTTTAGAGCCCCTGATTTTCAGAC
TATACATGCACTTGTACAGTGCACAACCGACTTATCAGCTCGAGGTTGCTATGATTGTTTAACCGCTATTTATTCAAGTTTGCCTGGCTG
TGGaTGTTAAAGXTGGGGAAACTACTATATAATGCCCAGCTGCATTGTTCGGTXATGAACCTTACTCATTCTTCAACGAATCATTATTGG
CTGAAGCTCCACCACCCTTA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan