ESTScan Details for Unigene SGN-U292243

Score 
483
Direction 
Reverse
Predicted Peptide Sequence 
MVVASLIAGMAFQAGVNPPGGVWEESEELTNQETPPHKAGQAVMAFIHPKSYRFFLRANTIAFVSSXQHNLAADKWIALQAQDFHVGFDG
YHVVDSFLKAVTYGVSIYILTPGKDSDALGQIIEIGIFVWCGLMALLLLGNTIRLLRVWQKKKHEIRSTAAQKFVNSTYVTV
Predicted Coding Sequence 
ATGGTGGTGGCCTCACTTATTGCAGGCATGGCATTCCAAGCTGGAGTGAACCCTCCAGGAGGTGTTTGGGAAGAAAGTGAAGAATTAACT
AATCAGGAAACACCCCCACATAAAGCTGGGCAGGCAGTAATGGCTTTTATTCATCCCAAATCGTATCGATTTTTTCTTCGTGCCAACACC
ATTGCCTTTGTTTCTTCTXCTCAGCACAATCTTGCTGCTGATAAGTGGATTGCCCTTCAGGCGCAGGATTTTCATGTGGGGTTTGATGGT
TATCATGTGGTCGACAGTTTCCTCAAAGCAGTCACTTATGGCGTATCAATTTACATCCTCACGCCTGGCAAGGACAGTGATGCACTTGGT
CAGATCATTGAAATTGGAATTTTCGTATGGTGTGGCTTAATGGCACTACTTCTACTCGGTAACACAATACGCTTGTTGCGTGTGTGGCAG
AAAAAGAAGCATGAAATAAGATCAACAGCAGCACAAAAATTTGTAAATTCAACATATGTCACTGTTTGA\
Edits in Original Sequence 
CGGTATATATAGGGGGAAATGAGGCTCAAAAGCCCCCATCAAAAGGTGATGGGCTTTCCAAAAAACGCGAGACAATA(5')ATGGTGGTG
GCCTCACTTATTGCAGGCATGGCATTCCAAGCTGGAGTGAACCCTCCAGGAGGTGTTTGGGAAGAAAGTGAAGAATTAACTAATCAGGAA
ACACCCCCACATAAAGCTGGGCAGGCAGTAATGGCTTTTATTCATCCCAAATCGTATCGATTTTTTCTTCGTGCCAACACCATTGCCTTT
GTTTCTTCTXCTCAGCACAATCTTGCTGCTGATAAGTGGATTGCCCTTCAGGCGCAGGATTTTCATGTGGGGTTTGATGGTTATCATGTG
GTCGACAGTTTCCTCAAtAGCAGTCACTTATGGCGTATCAATTTACATCCTCACGCCTGGCAAGGACAGTGATGCACTTGGTCAGATCAT
TGAAATTGGAATTTTCGTATGGTGTGGCTTAATGGCACTACTTCTACTCGGTAACACAATACGCTTGTTGCGTGTGTGGCAGAAAAAGAA
GCATGAAATAAGATCAACAGCAGCACAAAAATTTGTAAATTCAACATATGTCACTGTTTGA\(3')TCTGTTGCATTGACAAGCAGGACT
CAGCTATTACAAGAAATATGCATGACTGTTTTGAGAATCTAATTTCATTGTCATATGTTTGAGTTCAATAGCATAGACAAGTCCAAGCAA
AATAAATTTGTATCCTTCTAATTGGGAAAAAGTATAGACAAGTCCAAGCTAATAAAACAAAACTTCTTAAAAAAAAAAAAGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan