Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U292246

Score 
116
Direction 
Reverse
Predicted Peptide Sequence 
VLYLHWRWEAVAGVIAGFCXFHNDSNSFCNPTEVLFLHLSTFCGEKVYSAFNKVRLRRVCFLLAYVSFTSWLAVQYFRRIGLPEIAVYYS
MXALIFVEVLERVGS
Predicted Coding Sequence 
XGGGTTTTATACTTGCACTGGAGATGGGAAGCTGTAGCCGGAGTTATTGCTGGTTTCTGTXACTTCCATAATGACAGTAATTCTTTTTGC
AATCCTACGGAAGTTCTTTTCTTGCATCTATCAACTTTCTGTGGTGAGAAGGTTTACTCTGCCTTCAATAAAGTCCGTTTAAGGAGAGTT
TGTTTCCTGCTAGCTTATGTGTCATTTACTAGTTGGTTGGCCGTTCAATATTTCAGACGGATTGGTCTCCCTGAAATAGCAGTTTACTAT
AGCATGXTAGCACTCATTTTTGTAGAAGTGCTAGAGCGTGTTGGCAGTTAA\
Edits in Original Sequence 
(5')XGGGTTTTATACTTGCACTGGAGATGGGAAGCTGTAGCCGGAGTTATTGCTGGTTTCTGTXACTTCCATAATGACAGTAATTCTTT
TTGCAATCCTACGGAAGTTCTTTTCTTGCATCTATCAACTTTCTGTGGTGAGAAGGTTTACTCTGCCaTTCAATAAAGTCCGTTTAAGGA
GAGTTTGTTTCCTGCTAGCTTATGTGTCATTTACTAGTTGGTTGGCCGTTCAATATTTCAGACGGATTGGTCTCCCTGAAATAGCAGTTT
ACTATAGCATGXTAGCACTCATTTTTGTAGAAGTGCTAGAGCGTGTTGGCAGTTAA\(3')AGTTGAAATATGAAATTGTGTAATATCTT
TGTACCAGTAGACACAGTTTTCACATAGTGTTTCTACCATATGTTGTAATCTAGTTCCTTGTGTACAGAACAAACTGCAGGAATAAATAA
TAGTAAAAGTTTATCCCAGAGCATTATTCTGTGCCCAGGTGAATGAAGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan