ESTScan Details for Unigene SGN-U292407

Score 
35
Direction 
Forward
Predicted Peptide Sequence 
ESLSFFQEMLSKGISPNLIAYNTMIEALAKGRMVDKQXSLSSLRWWRIVAGPXEFTYSIILNVLAAEGQLGLLDEVVEISKRYMNKSIYA
YLVRTLSKIGHASEAHRLFCNMWSFHDRGDRDAYLSMLESLCNSKKVTEAIDLLNKMMKKGVKADSFMYNTVFLCSLRKAXKQDFLIFMI
FYETMKQX
Predicted Coding Sequence 
XGTGAATCACTTTCTTTCTTTCAGGAAATGCTGTCAAAGGGTATTTCACCAAATTTAATTGCTTATAATACTATGATCGAAGCTCTTGCG
AAAGGCCGCATGGTTGATAAGCAGXTATCTTTGTCTTCTCTAAGATGGTGGAGAATAGTTGCCGGCCCAAXTGAATTTACTTACAGTATT
ATTTTAAATGTATTGGCCGCAGAAGGGCAACTTGGACTGCTTGATGAAGTTGTGGAAATATCTAAGAGATACATGAATAAATCGATATAC
GCATATCTTGTTAGAACGTTGAGTAAAATAGGCCATGCAAGCGAAGCTCATAGGCTGTTTTGCAATATGTGGAGCTTCCATGATAGAGGA
GATCGTGATGCCTACTTATCCATGTTAGAGAGCTTATGCAATTCTAAGAAAGTAACTGAGGCTATTGATTTGCTGAATAAGATGATGAAA
AAGGGAGTAAAAGCAGATAGCTTCATGTATAATACCGTCTTTCTCTGCAGCTTGAGGAAGGCTAAXAAGCAAGATTTCCTCATCTTCATG
ATCTTCTATGAAACGATGAAGCAGGXX\
Edits in Original Sequence 
(5')XGTGAATCACTTTCTTTCTTTCAGGAAATGCTGTCAAAGGGTATTTCACCAAATTTAATTGCTTATAATACTATGATCGAAGCTCT
TGCGAAAGGCCGCATGGTTGATAAGCAGXTATCTTTGTCTTCTCTAAGATGGTGGAGAATAGTTGCCGGCCCAAXTGAATTTACTTACAG
TATTATTTTAAATGTATTGGCCGCAGAAGGGCAACTTGGACTGaCTTGATGAAGTTGTGGAAATATCTAAGAGATACATGAATAAATCGA
TATACGCATATCTTGTTAGAACGTTGAGTAAAATAGGCCATGCAAGCGAAGCTCATAGGCTGTTTTGCAATATGTGGAGCTTCCATGATA
GAGGAGATCGTGATGCCTACTTATCCATGTTAGAGAGCTTATGCAATTCTAAGAAAGTAACTGAGGCTATTGATTTGCTGAATAAGATGA
gTGAAAAAGGGAGTAAAAGCAGATAGCTTCATGTATAATACCGTCTTTCTCTGCAGCTTGAGGAAGGCTAAXAAGCAAGATTTCCTCATC
TTCATGATCTTCTATGAAACGATGAAGCAGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan