ESTScan Details for Unigene SGN-U292554

Score 
484
Direction 
Forward
Predicted Peptide Sequence 
NKPTYLKEFIYPKEDLIQAQEELNEPIIDLIGDINSVSMLVKTACLNHGFFQVINHGVDSKLINMAHAHVNHFFKLPLEVKLKVQKQHGS
LWGYSGAHAERFTSRLPWKETLSFNSHENGGPNQSGIVVDFFESSLGIEFEQMGLVFERYCKEMKRVGLVIMEILGISLGVEKCYYKDFF
KDTSSIMRCNFYPTCQDPNLVLGTPXHCDP
Predicted Coding Sequence 
AACAAACCAACATACCTXAAAGAATTCATTTATCCCAAAGAAGACTTAATACAAGCACAAGAGGAGCTAAATGAGCCAATAATAGACCTA
ATTGGAGACATCAATTCTGTGTCTATGCTTGTGAAAACAGCTTGCTTGAACCATGGATTCTTTCAAGTTATAAACCATGGAGTTGATTCT
AAATTAATTAACATGGCTCATGCTCATGTCAATCATTTCTTTAAGCTTCCATTAGAAGTAAAATTAAAGGTTCAAAAACAACATGGTAGT
TTGTGGGGTTATTCAGGTGCCCATGCAGAGAGATTTACTTCAAGATTGCCATGGAAAGAAACATTATCCTTCAATTCTCATGAAAATGGT
GGCCCTAATCAGAGTGGTATTGTTGTTGATTTCTTTGAATCTTCACTTGGAATAGAATTTGAACAAATGGGATTGGTGTTTGAGAGATAC
TGCAAGGAAATGAAGAGAGTAGGACTTGTAATCATGGAGATACTTGGTATAAGCCTTGGTGTAGAAAAATGTTACTACAAAGACTTTTTC
AAAGATACAAGTTCTATTATGAGATGTAATTTCTATCCAACTTGTCAAGATCCTAATTTAGTCCTTGGAACTCCANCTCATTGTGATCCX
\
Edits in Original Sequence 
(5')AACAAACCAACATACCTXAAAGAATTCATTTATCCCAAAGAAGACTTAATACAAGCACAAGAGGAGCTAAATGAGCCAATAATAGA
CCTAATTGGAGACATCAATTCTGTGTCTATGCTTGTGAAAACAGCTTGCTTGAACCATGGATTCTTTCAAGTTATAAACCATGGAGTTGA
TTCTAAATTAATTAACATGGCTCATGCTCATGTCAATCATTTCTTTAAGCTTCCATTAGAAGTAAAATTAAAGGTTCAAAAACAACATGG
TAGTTTGTGGGGTTATTCAGGTGCCCATGCAGAGAGATTTACTTCAAGATTGCCATGGAAAGAAACATTATCCTTCAATTCTCATGAAAA
TGGTGGCCCTAATCAGAGTGGTATTGTTGTTGATTTCTTTGAATCTTCACTTGGAATAGAATTTGAACAAATGGGATTGGTGTTTGAGAG
ATACTGCAAGGAAATGAAGAGAGTAGGACTTGTAATCATGGAGATACTTGGTATAAGCCTTGGTGTAGAAAAATGTTACTACAAAGACTT
TTTCAAAGATACAAGTTCTATTATGAGATGTAATTTCTATCCAACTTGTCAAGATCCTAATTTAGTCCTTGGAACTCCANCTCATTGTGA
TCCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan