ESTScan Details for Unigene SGN-U292811

Score 
307
Direction 
Reverse
Predicted Peptide Sequence 
NALNDILKSLPPAFAAFIANLPAVEGPSPDADFVISVCLQSNIPAATGKSGTASLPLQSGAAPSTSDLSDSSKFRPRDRQPGKRKDMDRQ
EDDESTTIQSQPLPRDLFKIRQLQKNRVGNSSRVTSSYTGSASSEVRFQEISRAALVDLRLVSSFQLSSRPDAMTEEPTYIPNSAICVW
Predicted Coding Sequence 
XXAAATGCCCTTAATGATATTTTGAAATCGTTACCCCCTGCATTTGCAGCGTTCATAGCAAATTTGCCAGCTGTTGAAGGTCCTTCTCCT
GATGCTGATTTTGTGATATCTGTATGTTTGCAAAGCAACATCCCTGCAGCAACTGGAAAATCCGGGACTGCCTCTCTGCCTTTGCAGTCA
GGCGCTGCTCCATCTACGAGTGACCTCTCTGATTCAAGCAAATTCAGGCCGAGAGACAGACAGCCGGGAAAGAGGAAAGACATGGACAGA
CAAGAGGATGATGAATCAACGACTATACAAAGCCAGCCCCTTCCTAGAGATCTTTTCAAGATTCGCCAATTACAAAAAAACCGTGTTGGT
AATTCGTCTCGAGTTACTAGTTCATACACAGGATCAGCATCATCGGAAGTGCGCTTTCAGGAGATCTCTCGGGCAGCACTAGTTGACCTC
AGACTTGTTTCTAGTTTTCAACTGAGCAGCAGACCTGACGCGATGACAGAAGAGCCGACATACATTCCAAACTCTGCCATTTGCGTCTGG
\
Edits in Original Sequence 
(5')XXAAATGCCCTTAATGATATTTTGAAATCGTTACCCCCTGCATTTGCAGCGTTCATAGCAAATTTGCCAGCTGTTGAAGGTCCTTC
TCCTGATGCTGATTTTGTGATATCTGTATGTTTGCAAAGCAACATCCCTGCAGCAACTGGAAAATCCGGGACTGCCTCTCTGCCTTTGCA
GTCAGGCGCTGCTCCATCTACGAGTGACCTCTCTGATTCAAGCAAATTCAGGCCGAGAGACAGACAGCCGGGAAAGAGGAAAGACATGGA
CAGACAAGAGGATGATGAATCAACGACTATACAAAGCCAGCCCCTTCCTAGAGATCTTTTCAAGATTCGCCAATTACAAAAAAACCGTGT
TGGTAATTCGTCTCGAGTTACTAGTTCATACACAGGATCAGCATCATaCGGAAGTGCGCTTTCAGGAGATCTCTCGGGCAGCACTAGTTG
ACCTCAGACTTGTTTCtTAGTTTTCAACTGAGCAGCAGACCTGACGCGAcTGACAGAAGAGCCGACATACATTCCAAACTCTGCCATTTG
CGTCTGG\(3')TCATTCTGTAGTGTACTCTATTTTGCAAAGATGTAATATTAACATTTACATGTCATTATAATTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan