ESTScan Details for Unigene SGN-U292898

Score 
589
Direction 
Forward
Predicted Peptide Sequence 
MGRKKATEENSEPPKQGGGGGKSKKKNRVIDDDEYSIQTEEPTVQEETALPPAGKKAANKSGDKDDEKEEDDDEGKKPAKHGGGDGWKSR
KKYVVINDDX
Predicted Coding Sequence 
ATGGGGAGAAAGAAGGCAACAGAAGAGAATTCTGAACCTCCCAAGCAGGGCGGTGGAGGAGGGAAGTCTAAGAAGAAGAATAGGGTGATT
GATGACGATGAGTACTCTATTCAGACTGAAGAACCTACAGTTCAGGAAGAGACAGCACTACCACCTGCTGGTAAGAAGGCGGCCAATAAG
TCAGGGGACAAAGATGACGAGAAAGAAGAAGATGATGATGAGGGAAAGAAGCCGGCCAAACACGGTGGTGGTGATGGATGGAAGTCAAGG
AAAAAATATGTGGTAATTAATGATGATGAX\
Edits in Original Sequence 
CTCAATCTCTCTTCAGTGTTACAGGGTTTTTGATTCGTTGAAGTAATACTAAAACTAGTGGTGAAGTTCA(5')ATGGGGAGAAAGAAGG
CAACAGAAGAGAATTCTGAACCTCCCAAGCAGGGCGGTGGAGGAGGGAAGTCTAAGAAGAAGAATAGGGTGATTGATGACGATGAGTACT
CTATTCAGACTGAAGAACCTACAGTTCAGGAAGAGACAGCACTACCACCTGCTGGTAAGAAGGCGGCCAATAAGTCAGGGGACAAAGATG
ACGAGAAAGAAGAAGATGATGATGAGGGAAAGAAGCCGGCCAAACACGGTGGTGGTGATGGATGGAAGTCAAGGAAAAAATATGTGGTAA
TTAATGATGATGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan