ESTScan Details for Unigene SGN-U292920

Score 
450
Direction 
Forward
Predicted Peptide Sequence 
KVWDVWQVVRQYYEQTDDFDGXVLLQIFPAAISCDYTFILKPSEKASGACMILAELVVDTGLPNGVLNVIHGTNDIVNAICDDDDIEVVS
FVGPDAAQLYMRGRPFANNSKGAKGHGAQQLTLVFVGGSKLWEDKLQNXAKVLKVNAGTVPGAGLRPVITNRSRNGFQAIVDSGAKTNPW
MGDKL
Predicted Coding Sequence 
AAGGTTTGGGATGTTTGGCAAGTGGTAAGACAGTACTATGAACAAACTGATGACTTTGATGGTGXAGTTCTTTTGCAGATCTTCCCAGCT
GCAATTTCATGTGACTATACATTCATTCTAAAACCATCAGAGAAAGCTTCAGGGGCTTGCATGATACTAGCAGAGTTAGTTGTAGACACT
GGTTTGCCTAATGGTGTCTTAAATGTTATTCATGGCACCAATGACATTGTCAATGCCATCTGTGATGATGATGATATTGAGGTTGTGTCT
TTTGTTGGTCCTGATGCTGCTCAACTGTATATGCGTGGCAGACCATTTGCGAACAACAGTAAAGGTGCTAAGGGCCACGGTGCACAACAA
TTAACACTGGTCTTTGTTGGAGGTTCAAAATTATGGGAAGATAAACTACAGAATGXTGCAAAGGTACTAAAAGTAAATGCTGGAACTGTG
CCTGGTGCTGGCCTCAGACCAGTAATTACAAACAGGTCAAGGAACGGATTCCAAGCAATTGTTGATAGTGGAGCCAAAACTAATCCTTGG
ATGGGAGACAAGTTGTAA\
Edits in Original Sequence 
TTTTTTATCATGAATTAGCCCTTAGAGAAGTCTAGCAGATGTTTTGCTTAAAAGAAGTGTAGGTTAAACTGCACTTTTTTAAAAATCATT
TATTTGTTTCCTCTCTCAAGTCTC
(5')AAGGTTTGGGATGTTTGGCAAGTGGTAAGACAGTACTATGAACAAACTGATGACTTTGATGG
TGXAGTTCTTTTGCAGATCTTCCCAGCTGCAATTTCATGTGACTATACATTCATTCTAAAACCATCAGAGAAAGCTTCAGGGGCTTGCAT
GATACTAGCAGAGTTAGTTGTAGACACTGGTTTGCCTAATGGTGTCTTAAATGTTATTCATGGCACCAATGACATTGTCAATGCCATCTG
TGATGATGATGATATTGAGGTTGTGTCTTTTGTTGGTCCTGATGCTGCTCAACTGTATATGCGTGGCAGACCATTTGCGAACAACAGTAA
AGGTGCTAAGGGCCACGGTGCACAACAATTAACACTGGTCTTTGTTGGAGGTTCAAAATTATGGGAAGATAAACTACAGAATGXTGCAAA
GGTACTAAAAGTAAATGCTGGAACTGTGCCTGGTGCTGGCCTCAGACCAGTAATTACAAACAGGTCAAGGAACGGATTCCAAGCAATTGT
TGATAGTGGAGCCAAAACTAATCCTTGGATGGGAGACAAGTTGTAA\(3')TTGCTATGGAACATCTATCTTCACG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan