ESTScan Details for Unigene SGN-U292950

Score 
485
Direction 
Forward
Predicted Peptide Sequence 
EKDPYLGRVLTGRVTCGVVRVGDKVQGLKNTDNGTVKIEEGKVVKLMKKKGMRADPVDSAGAGDIVSMAGLSSPTIGHTVANAEVTTALP
TVVLDPPTISMTFGVNDSPLAGSDGIHLTGGKIGDRLLAESETNLAINVLPSTSESFEVQGRGELQLGILIENMRREGFELSVSPPKVMY
KVEKGLKLEPIEEVTIEVDDEARKVSVMEDTFS
Predicted Coding Sequence 
GAGAAAGATCCTTATCTTGGTCGTGTTTTGACGGGTCGTGTAACTTGTGGAGTTGTTCGTGTTGGTGATAAAGTACAAGGGCTGAAGAAC
ACAGACAATGGAACTGTAAAAATTGAAGAAGGAAAGGTTGTAAAGCTGATGAAAAAGAAGGGTATGAGAGCAGATCCAGTAGATAGTGCT
GGTGCAGGTGACATAGTGTCCATGGCAGGTTTGTCAAGTCCGACAATTGGACACACAGTTGCGAATGCAGAGGTTACGACAGCGTTGCCC
ACAGTTGTGCTTGACCCCCCTACCATCTCCATGACTTTCGGTGTCAATGATTCTCCCTTAGCTGGTTCTGATGGTATTCATTTGACTGGA
GGGAAAATTGGTGACCGGCTGCTAGCTGAATCAGAAACCAATCTTGCCATAAATGTTCTCCCCAGTACGTCAGAATCATTTGAAGTGCAG
GGTAGAGGTGAACTTCAATTAGGTATCTTAATTGAGAACATGAGACGTGAAGGATTTGAGCTCTCCGTCTCCCCACCTAAAGTCATGTAC
AAAGTAGAGAAAGGACTTAAGCTTGAGCCAATTGAAGAAGTGACTATTGAGGTTGATGACGAAGCACGTAAGGTTTCGGTCATGGAAGAC
ACTTTCTCA\
Edits in Original Sequence 
(5')GAGAAAGATCCTTATCTTGGTCGTGTTTTGACGGGTCGTGTAACTTGTGGAGTTGTTCGTGTTGGTGATAAAGTACAAGGGCTGAA
GAACACAGACAATGGAACTGTAAAAATTGAAGAAGGAAAGGTTGTAAAGCTGATGAAAAAGAAGGGTATGAGAGCAGATCCAGTAGATAG
TGCTGGTGCAGGTGACATAGTGTCCATGGCAGGTTTGTCAAGTCCGACAATTGGACACACAGTTGCGAATGCAGAGGTTACGACAGCGTT
GCCCACAGTTGTGCTTGACCCCCCTACCATCTCCATGACTTTCGGTGTCAATGATTCTCCCTTAGCTGGTTCTGATGGTATTCATTTGAC
TGGAGGGAAAATTGGTGACCGGCTGCTAGCTGAATCAGAAACCAATCTTGCCATAAATGTTCTCCCCAGTACGTCAGAATCATTTGAAGT
GCAGGGTAGAGGTGAACTTCAATTAGGTATCTTAATTGAGAACATGAGACGTGAAGGATTTGAGCTCTCCGTCTCCCCACCTAAAGTCAT
GTACAAAGTAGAGAAAGGtACTTAAGCTTGAGCCAATTGAAGAAGTGACTATTGAGGTTGAtTGACGAAGCACGTAAGGTTTCGGTCATG
GAAGACACTTTCTCA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan