ESTScan Details for Unigene SGN-U293037

Score 
370
Direction 
Reverse
Predicted Peptide Sequence 
ELSFQGWTQQVQDMFDTKKFGDIAVRDKDFKNAVDYYSKLVSMMSVPSGTVFVRRALSYMMNGQPELALRDAMQAQVCLPDWPTAFYMQA
LALSKLGMETDAQDMLNDGASFEAKKLTVGVTDSGTFDVSRNLTSFNATRGSYSKDETGEEPKXNVVFGDYINLAPRSFVANTVPYRKCI
NHSSENPRSSLFCDECQFLX
Predicted Coding Sequence 
XATGAGCTCTCATTCCAAGGATGGACGCAACAAGTTCAAGATATGTTCGATACCAAGAAATTTGGGGATATTGCTGTTCGGGACAAGGAT
TTCAAGAATGCAGTTGACTATTACTCTAAGTTAGTATCAATGATGTCTGTTCCTTCTGGCACTGTTTTCGTGAGGCGAGCCCTTTCCTAC
ATGATGAATGGCCAACCAGAACTCGCACTAAGGGATGCTATGCAAGCCCAGGTGTGCTTGCCCGACTGGCCTACTGCATTCTATATGCAG
GCTCTTGCCCTATCCAAGCTTGGTATGGAAACTGATGCACAAGACATGCTCAATGATGGTGCCTCCTTTGAAGCAAAGAAGTTAACAGTT
GGCGTAACTGATTCTGGCACGTTTGATGTATCAAGAAACCTCACATCCTTTAATGCAACTAGAGGTAGCTATAGTAAGGATGAGACAGGA
GAGGAACCAAAGGXTAATGTGGTGTTTGGGGATTATATTAATCTCGCCCCTCGCTCTTTTGTAGCCAATACAGTTCCATACAGAAAATGT
ATAAATCACTCTAGTGAGAACCCTCGTAGTAGTTTATTCTGCGATGAATGCCAATTTTTAGXX\
Edits in Original Sequence 
(5')XATGAGCTCTCATTCCAAGGATGGACGCAACAAGTTCAAGATATGTTCGATACCAAGAAATTTGGGGATATTGCTGTTCGGGACAA
GGATTTCAAGAATGCAGTTGACTATTACTCTAAGTTAGTATCAATGATGTCTGTTCCTTCTGGCACTGTTTTCGTGAGGCGAGCCCTTTC
CTACATGATGAATGGCCAACCAGAACTCGCACTAAGGGATGCTATGCAAGCCCAGGTGTGCTTGCCCGACTGGCCTACTGCATTCTATAT
GCAGGCTCTTGCCCTATCCAAGCTTGGTATGGAAACTGATGCACAAGACATGCTCAATGATGGTGCCTCCTTTGAAGCAAAGAAGTTaAA
CAGTTGGCGTAACTGATTCTGGCACGTTTGATGTATCAAGAAACCTCACATCCTTTAATGCAACTAGAGGTAGCTATAGTAAGGATGAGA
CAGGAGAGGAACCAAAGGXTAATGTGGTGTTTGGGGATTATATTAATCTCGCCCCTCGCTCTTTTGTAGCCAATACAGTTCCATACAGAA
AATGTATAAATCACTCTAGTGAGAACCCTCGTAGTAGTTTATTCTGCGATGAATGCCAATTTTTAGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan