ESTScan Details for Unigene SGN-U293038

Score 
208
Direction 
Forward
Predicted Peptide Sequence 
MSSTIGVIDAIDFTEYGAEESIACPDCNTGFVEEIEAPTRSTLSGSRRRRIPPAVMQTAARSTEQSPASGYGSGSSPGVRRNRRNTGDRS
PFNPVIVLRGSTNGGGAGGEGGGGGGGGGGGFELYYDDGTGSGLRPLPTSMSEFLTRGQSYDRLLD
Predicted Coding Sequence 
ATGTCGTCAACTATTGGTGTTATAGATGCAATAGATTTTACAGAGTATGGAGCXGAGGAATCGATTGCTTGTCCTGATTGTAACACGGGA
TTTGTTGAAGAAATTGAGGCTCCGACCCGATCCACGTTGTCCGGGTCACGGCGTCGGCGTATTCCTCCGGCGGTGATGCAGACGGCAGCG
CGGAGTACGGAGCAGTCTCCTGCTTCGGGTTATGGTTCCGGGTCAAGTCCGGGTGTTCGTAGGAACCGGAGGAATACTGGTGACCGGTCG
CCGTTTAATCCTGTGATAGTCCTTCGTGGTTCTACCAATGGAGGTGGCGCGGGAGGGGAAGGTGGTGGAGGTGGTGGAGGCGGTGGAGGG
GGGTTTGAACTGTATTATGATGATGGAACCGGGTCGGGTTTGAGACCTTTACCTACGAGTATGTCTGAGTTTCTTACTCGGGGTCAGAGT
TACGATAGGCTTTTGGAT\
Edits in Original Sequence 
TGGATCTGAAAGTGTGTTTTGAAGAATTTGTTTCTGGGGTTGTGGGAATTTTGTATTGATTGACTTTTGGATTTCAAGTTCAGATTTTTT
TCG
(5')ATGTCGTCAACgTATTGGTGTTATAGATGCAATAGATTTTACAGAGTATGGAGCXGAGGAATCGATTGCTTGTCCTGATTGTA
ACACGGGATTTGTTGAAGAAATTGAGGCTCCGACCCGATCCACGTTGTCCGGGTCACGGCGTCGGCGTATTCCTCCGGCGGTGATGCAGA
CGGCAGCGCGGAGTACGGAGCAGTCTCCTGCTTCGGGTTATGGTTCCGGGTCAAGTCCGGGTGTTCGTAGGAACCGGAGGAATACTGGTG
ACCGGTCGCCGTTTAATCCTGTGATAGTCCTTCGTGGTTCTACCAATGGAGGTGGCGCGGGAGGGGAAGGTGGTGGAGGTGGTGGAGGCG
GTGGAGGGGGGTTTGAACTGTATTATGATGATGGAACCGGGTCGGGTTTGAGACCTTTACCTACGAGTATGTCTGAGTTTCTTACTCGGG
GTCAGAGTTACGATAGGCTTTTGGAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan