ESTScan Details for Unigene SGN-U293047

Score 
658
Direction 
Reverse
Predicted Peptide Sequence 
EMLRASETPDDVTYIGVLSACTHMGMVDEGKSFFANMASQHGIQPNVIHYGCLVDLLGRAGHLEGAYEVIKSMPVKPNPIVWGALLGACR
IHKDVQMAEIAAQQLLQLEPGNGAVYVLLCNIYAACKKWDNLRETRRIMTDRGIKKTPGCSLIEMHGIVHEFVAGDQSHPQSKSIYSKLA
ELIGELKYSGYVPDTSEVSLDIGEDEKENSLSRHSEKLAIAFALINSEPGFTIRIVKNLRXMYRLPPCSKVNIGTLEEKTNYCQKSV
Predicted Coding Sequence 
GAGATGCTGAGAGCTTCAGAAACACCGGATGATGTGACTTACATTGGTGTTCTTAGTGCTTGTACTCATATGGGTATGGTAGACGAAGGA
AAAAGCTTCTTCGCAAACATGGCCTCTCAGCATGGCATTCAACCTAATGTTATACATTATGGCTGTCTGGTTGATCTTCTTGGTCGAGCA
GGGCATTTGGAGGGAGCTTATGAAGTTATAAAGAGTATGCCAGTGAAACCAAATCCAATTGTTTGGGGAGCTCTTCTTGGTGCTTGCAGA
ATTCACAAGGATGTTCAAATGGCTGAAATTGCAGCTCAACAACTTCTTCAGCTAGAGCCTGGAAACGGGGCTGTCTATGTTCTCTTGTGT
AATATATATGCAGCTTGCAAAAAATGGGATAACTTGCGCGAAACAAGAAGAATAATGACAGATCGCGGGATCAAGAAGACACCAGGTTGT
AGTCTGATAGAGATGCATGGAATTGTTCATGAATTCGTTGCAGGGGATCAGTCTCATCCTCAATCTAAAAGCATATATTCAAAGTTGGCT
GAGTTGATTGGAGAATTAAAATATTCCGGTTATGTTCCAGATACTTCAGAGGTTTCTCTTGACATAGGAGAAGATGAGAAAGAGAACTCC
CTTAGTCGACACAGTGAGAAGTTGGCGATTGCATTTGCTCTAATCAATTCTGAACCTGGATTCACTATTAGGATAGTGAAAAACCTTAGA
XATATGTACAGATTGCCACCATGTAGCAAAGTTAATATCGGAACGTTAGAAGAAAAAACTAATTATTGCCAAAAAAGTGTG\
Edits in Original Sequence 
(5')GAGATGCTGAGAGCTTCAGAAACACCGGATGATGTGACTTACATTGGTGTTCTTAGTGCTTGTACTCATATGGGTATGGTAGACGA
AGGAAAAAGCTTCTTCGCAAACATGGCCTCTCAGCATGGCATTCAACCTAATGTTATACATTATGGCTGTCTGGTTGATCTTCTTGGTCG
AGCAGGGCATTTGGAGGGAGCTTATGAAGTTATAAAGAGTATGCCAGTGAAACCAAATCCAATTGTTTGGGGAGCTCTTCTTGGTGCTTG
CAGAATTCACAAGGATGTTCAAATGGCTGAAATTGCAGCTCAACAACTTCTTCAGCTAGAGCCTGGAAACGGGGCTGTCTATGTTCTCTT
GTGTAATATATATGCAGCTTGCAAAAAATGGGATAACTTGCGCGAAACAAGAAGAATAATGACAGATCGCGGGATCAAGAAGACACCAGG
TTGTAGTCTGATAGAGATGCATGGAATTGTTCATGAATTCGTTGCAGGGGATCAGTCTCATCCTCAATCTAAAAGCATATATTCAAAGTT
GGCTGAGTTGATTGGAGAATTAAAATATTCCGGTTATGTTCCAGATACTTCAGAGGTTTCTCTTGACATAGGAGAAGATGAGAAAGAGAA
CTCCCTTAGTCGACACAGTGAGAAGTTGGCGATTGCATTTGCTCTAATCAATTCTGAACCTGGATTCACTATTAGGATAGTGAAAAACCT
TAGAXATATGTACAGATTGCCACCATGTAGCAAAGTTAATATCGGAACGTTAGAAGAAAAAACTAATTATTGCCAAAAAAGTGTG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan