ESTScan Details for Unigene SGN-U293053

Score 
492
Direction 
Reverse
Predicted Peptide Sequence 
DKLDIAESNGLGETADFDIKLGQSLPPSLFPYLRLVALGGTDNSLIESISGNAVWNLLELPVSRANEELICKVVRDSCRSALSGYHTTIE
EDEKLMKEGNLSSRLQIAVGVRAGEKKVLQQLDEIFRERELELDELEYYQERRLKDLDLVGEPKKELSADLMSILVEXITAWTSKAKADL
EF
Predicted Coding Sequence 
XGGGACAAGCTGGATATAGCAGAGTCAAATGGCCTAGGAGAAACTGCTGACTTTGACATAAAACTTGGACAATCTCTCCCTCCTTCTCTA
TTTCCATATCTTAGGCTGGTTGCCCTTGGTGGAACTGATAATTCCCTAATAGAATCAATTTCTGGAAATGCTGTTTGGAATCTTCTCGAG
TTGCCTGTCAGCAGAGCAAACGAAGAGCTCATATGTAAAGTTGTACGAGATTCATGCAGATCTGCACTTTCTGGATATCACACCACAATT
GAAGAGGATGAGAAACTGATGAAGGAAGGGAACCTCAGTTCAAGGCTTCAGATAGCAGTAGGGGTGAGAGCAGGGGAGAAGAAGGTTTTA
CAACAACTCGACGAAATTTTTAGAGAAAGAGAACTGGAACTAGATGAATTAGAGTACTACCAAGAAAGGAGGCTTAAAGATCTTGATCTT
GTTGGAGAGCCAAAGAAGGAACTCTCTGCTGACCTTATGAGCATTCTAGTTGAGXTTATAACAGCTTGGACTTCAAAGGCAAAGGCGGAT
CTAGAATTTTAA\
Edits in Original Sequence 
(5')XGGGACAAGCTGGATATAGCAGAGTCAAATGGCCTAGGAGAAACTGCTGACTTTGACATAAAACTTGGACAATCTCTCCCTCCTTC
TCTATTTCCATATCTTAGGCTGGTTGCCCTTGGTGGAACTGATAATTCCCTAATAGAATCAATTTCTGGAAATGCTGTTTGGAATCTTCT
CGAGTTGCCTGTCAGCAGAGCAAACGAAGAGCTCATATGTAAAGTTGTACGAGATTCATGCAGATCTGCACTTTCTGGATATCACACCAC
AATTGAAGAGGATGAGAAACTGATGAAGGAAGGGAACCTCAGTTCAAGGCTTCAGATAGCAGTAGGGGTGAGAGCAGGGGAGAAGAAGGT
TTTACAACAACTCGACGAAATTTTTAGAGAAAGAGAACTGGAACTAGATGAATTAGAGTACTACCAAGAAAGGAGGCTTAAAGATCTTGA
TCTTGTTGGAGAGCCAAAGtAAGGAACTCTCTGCTGACCTTATGAGCATTCTAGTTGAGXTTATAACAGCTTGGACTTCAAAGGCAAAGG
CGGATCTAGAATTTTAA\(3')GTATATAGGTTCCTATAAGAACCTCAACTTAGCTATTTGACTTCTCAGCACACAATTCGAATTTTCTC
CAAGTACCCTTTTTTGGGCATGACAATTAGATAAATGAACAAACTGTTACATCTCTTTGCTCCACATTTTAGAGCATTTGATTGGAGAAG
TAAAGGTTATATTCCGTAAAAAAAGATTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan