ESTScan Details for Unigene SGN-U293461

Score 
224
Direction 
Reverse
Predicted Peptide Sequence 
AIEGVRQEMQADMDRKFQEEREKMRAEMDKMFQAQMEEERRQMRVEIDKRIQDQMVANLMVGMQQGQGSSTARVSKGKKQKSPEVSWGVK
RKRK
Predicted Coding Sequence 
GCAATAGAAGGTGTGCGCCAAGAGATGCAAGCTGACATGGATCGTAAGTTTCAAGAGGAACGTGAAAAAATGCGAGCTGAAATGGACAAA
ATGTTTCAAGCACAGATGGAAGAGGAGCGCCGACAAATGCGAGTAGAAATAGACAAAAGGATCCAAGATCAGATGGTGGCTAATTTAATG
GTTGGAATGCAACAGGGTCAAGGTTCTTCAACTGCCCGAGTTAGCAAAGGCAAAAAGCAAAAAAGCCCTGAAGTCAGTTGGGGTGTCAAG
CGTAAGCGTAAGTAA\
Edits in Original Sequence 
(5')GCAATAGAAGGTGTGCGCCAAGAGATGCAAGCTGACATGGATCGTAAGTTTCAAGAGGAACGTGAAAAAATGCGAGCTGAAATGGA
CAAAATGTTTCAAGCACAGATGGAAGAGGAGCGCCGACAAATGCGAGTAGAAATAGACAAAAGGATCCAAGATCAGATGGTGGCTAATTT
AATGGTTGGAATGCAACAGGGTCAAGGTTCTTCAACTGCCCGAGTTAGCAAAGGCAAAAAGCAAAAAAGCCCTGAAGTCAGTTGGGGTGT
CAAGCGTAAGCGTAAGTAA\(3')ACCTCCCAGGTTTAATGAACAAATGTGGAAGAGATTTTTACTCACTGTGATATTCAGGTGTTAATT
TATTTATCATTTAGTCTGTTTTTGCCTTCCTTACCCGGTATAACGAACTTTTGTATAATTTGTAAATATTAGATTGTTGAAAAAAAAAAA
AAAGGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan