ESTScan Details for Unigene SGN-U293482

Score 
292
Direction 
Forward
Predicted Peptide Sequence 
MEKDAXGGVTGGMANLGCHHLKLIYANMEGDALHSLRVNLQDPNNVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAALSGLLVPQLG
LLKNLQYLELYSNNISGLIPSDLGNLTNLVSLDLYLNNFLGPIPDSLGKL
Predicted Coding Sequence 
ATGGAGAAGGATGCTGXTGGTGGTGTCACTGGTGGTATGGCTAATCTTGGTTGTCATCATCTTAAGCTCATTTATGCTAATATGGAAGGT
GATGCATTGCATAGTCTACGCGTCAATTTACAAGATCCTAACAATGTGCTACAGAGCTGGGACCCTACCCTTGTTAATCCTTGCACATGG
TTTCATGTTACCTGCAACAATGACAACAGCGTTATAAGAGTTGATTTAGGAAATGCAGCTTTATCTGGTCTGTTAGTCCCACAGCTTGGC
CTTTTGAAGAATTTGCAGTACTTGGAGCTTTACAGTAATAACATAAGTGGTCTAATACCGAGTGATCTTGGGAATTTGACTAATTTGGTC
AGCTTGGATCTCTACTTGAACAACTTCCTCGGTCCCATCCCAGATTCCTTGGGCAAGCTX\
Edits in Original Sequence 
CTCGAGGTTTTCTTGAATTTTTGGGTAAATGCTGGCTTTTTTGAGTTTGCTTTACTTGGATCTACGAGATTGTTTTGTCAGCTGGCTGCT
TGATTTGTAAAAAAAAAAAAACAGTATTTTGATGGTGAAGGTG
(5')ATGGAGAAGGATGCTGXTGGTGGTGTCACTGGTGGTATGGCTA
ATCTTGGTTGTaCATCATCTTAAGCTCATTTATGCTAATATGGAAGGTGATGCATTGCATAGTCTACGCGTCAATTTACAAGATCCTAAC
AATGTGCTACAGAGCTGGGACCCTACCCTTGTTAATCCTTGCACATGGTTTCATGTTACCTGCAACAATGACAACAGCGTTATAAGAGTT
GATTTAGGAAATGCAGCTTTATCTGGTCTGTTAGTCCCACAGCTTGGCCTTTTGAAGAATTTGCAGTACTTGGAGCTTTACAGTAATAAC
ATAAGTGGTCTAATACCGAGTGATCTTGGGAATTTGACTAATTTGGTCAGCTTGGATCTCTACTTGAACAACTTCCTCGGTCCCATCCCA
GATTCCTTGGGCAAGCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan