ESTScan Details for Unigene SGN-U293537

Score 
163
Direction 
Forward
Predicted Peptide Sequence 
MSSRRSRSRISDDQIADLVSKLQQQFPEIRNRRSDKVSGSKVLQETCNYIRNLHREVDGLSERLSQLLESTDSDSAQAAIIXKLTYVAI
Predicted Coding Sequence 
ATGTCAAGCAGACGATCACGTTCCAGAATAAGCGATGATCAAATCGCTGATCTTGTTTCCAAGTTGCAACAACAATTCCCTGAAATTCGC
AATAGACGTTCTGACAAGGTTTCAGGTTCAAAAGTGCTGCAAGAGACTTGCAACTATATAAGAAATTTACACAGAGAAGTGGATGGATTA
AGTGAGAGATTATCACAACTTTTGGAATCAACTGATAGTGATAGTGCTCAAGCTGCTATTATTAXGAAGCTTACTTATGTAGCTATTTAA
\
Edits in Original Sequence 
ATTCTATTCTATCTGACAACTCACTTAACAACAACAACAACTCTTTCTCCCATGGGGGTGTTCTCTGCCCCTTTTGTGCTTTCTTCAGTT
TCATTATATATA
(5')ATGTCAAGCAGACGATCACGTTCCAGAATAAGCGATGATCAAATCGCTGATCTTGTTTCCAAGTTGCAACAACt
AATTCCCTGAAATTCGCAATAGACGTTCTGACAAGGTTTCAGGTTCAAAAGTGCTGCAAGAGACTTGCAACTATATAAGAAATTTACACA
GAGAAGTGGATGGATTAAGTGAGAGATTATCACAACTTTTGGAATCAACTGATAGTGATAGTGCTCAAGCTGCTATTATTAXGAAGCTTA
CTTATGTAGCTATTTAA\(3')TTAAATAGCTCAATTCATTAAAATTTCTATTATTAACAAAAGATGGCAGTATTTATATTCATTGATTC
AGGTTTTTTGGCCACTATAGGTCAAAATTAATTTCTATGTTTTCTGTTTTGCCAATTTTCGAATAGTTCTTTCACTTTATGTAGTATTGT
TGTATCCATCTGTTTTAAGAGCTGATGTCTCTTTGATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan