ESTScan Details for Unigene SGN-U293580

Score 
431
Direction 
Reverse
Predicted Peptide Sequence 
SERVEKLGMASKGCEGDEEGDGGSSGSSDNEMDPNYVSRKDGYYERNVRDENDINEHENESSVFSAPMPVKMEARAADYINRKKGVKIVD
N
Predicted Coding Sequence 
AGTGAAAGAGTTGAAAAACTTGGCATGGCATCCAAGGGTTGTGAAGGTGATGAGGAAGGAGATGGAGGGTCTAGTGGAAGTAGTGATAAT
GAAATGGATCCAAATTACGTTTCAAGAAAGGATGGCTATTATGAAAGGAATGTGAGAGATGAGAATGATATTAATGAGCACGAAAATGAA
AGTTCCGTGTTCTCAGCACCTATGCCTGTGAAGATGGAAGCTAGAGCTGCTGATTATATCAACAGGAAAAAGGGTGTCAAAATAGTTGAC
AATTGA\
Edits in Original Sequence 
(5')AGTGAAAGAGTTGAAAAACTTGGCATGGCATCCAAGGGTTGTGAAGGTGATGAGGAAGGAGATGGAGGGTCTAGTGGAAGTAGTGA
TAATGAAATGGATCCAAATTACGTTTCAAGAAAGGATGGCTATTATGAAAGGAATGTGAGAGATGAGAATGATATTAATGAGCACGAAAA
TGAAAGTTCCGTGTTCTCAGCACCTATGCCTGTGAAGATGGAAGCTAGAGCTGCTGATTATATCAACAGGAAAAAGGGTGTCAAAATAGT
TGACAATTGA\(3')ATAGGTTTCCCAACAGGATCAAGATTTGAACTTTGCTCTCCTACAGGTCCTGTTGAGCATTAACAATTAGGTGGA
AGTTAGGCTTGTGCTGTTCTTGCGAATTGTTTGTAATTGTTAGTAATGATTGTCTAGATGAGTATTGTTAGGTTTGATATGGAGAGTTCA
CCTGTTTTGAAGTACTAAATTTAGATGTTTTCTTCTGTCATTGTGGTTATGGATGGGAGATCTTTTGGGTGTAATGGACCCTATTCTGGG
GTTTTTAATGAATGATTGTTGAAGAGTTAAAAAGATGTCACATTTTATTCAACATAAATTAAGCAATGGCTATTTCCTGGAGACCAAATT
ATGATNN

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan