ESTScan Details for Unigene SGN-U293612

Score 
392
Direction 
Forward
Predicted Peptide Sequence 
YVPISVVASFKKIKALIGSHAQLAEVLRRSINLVVSEDGKKVKRQNPLTEAALEELQSRIVVAENLPXGPLPPEPHEDFFSSWKGKNDTD
LPPQPSNGGASSASRSAKSDSTMYSNKLHAFVEYDAVELAEKAVLELNDVDNWRNGLKVHLLLRRTXKSGQARVKKVGHESDPNSKEDDD
VAFELNEX
Predicted Coding Sequence 
XXGTATGTACCAATATCAGTGGTTGCATCATTCAAGAAGATTAAAGCTCTAATAGGTAGTCATGCTCAGCTTGCCGAAGTTCTGCGCCGC
TCAATAAATCTTGTAGTTAGTGAAGATGGAAAGAAAGTTAAACGGCAAAATCCTCTGACTGAAGCTGCCCTAGAGGAGTTGCAGTCTCGC
ATAGTGGTTGCTGAGAATTTGCCTGXAGGACCACTGCCACCAGAACCTCATGAAGATTTTTTCAGCAGTTGGAAGGGTAAAAATGATACG
GACCTGCCCCCTCAGCCTTCAAATGGTGGGGCTTCTTCAGCATCTAGATCAGCAAAATCAGACAGCACGATGTATAGTAACAAGTTGCAC
GCATTTGTGGAGTACGACGCTGTAGAATTGGCTGAGAAGGCGGTTCTTGAGCTAAATGACGTGGATAATTGGCGAAATGGTCTAAAAGTC
CATCTGCTGCTTAGACGCACAGNCAAATCTGGTCAAGCCCGAGTGAAGAAGGTTGGTCATGAAAGTGATCCGAACTCCAAAGAAGATGAT
GATGTTGCATTTGAACTCAATGAGAXX\
Edits in Original Sequence 
(5')XXGTATGTACCAATATCAGTGGTTGCATCATTCAAGAAGATTAAAGCTCTAATAGGTAGTCATGCTCAGCTTGCCGAAGTTCTGCG
CCGCTCAATAAATCTTGTAGTTAGTGAAGATGGAAAGAAAGTTAAACGGCAAAATCCTCTGACTGAAGCTGCCCTAGAGGAGTTGCAGTC
TCGCATAGTGGTTGCTGAGAATTTGCCTGXAGGACCACTGCCACCAGAACCTCATGAAGATTTTTTCAGCAGTTGGAAGGGTAAAAATGA
TACGGACCTGCCaCCCTCAGCCTTCAAATGGTGGGGCTTCTTCAGCATCTAGATCAGCAAAATCAGACAGCACGATGTATAGTAACAAGT
TGCACGCATTTGTGGAGTACGACGCTGTAGAATTGGCTGAGAAGGCGGTTCTTGAGCTAAATGACGTGGATAATTGGCGAAATGGTCTAA
AAGTCCATCTGCTGCTTAGACGCACAGNCAAATCTGGTCAAGCCCGAGTGAAGAAGGTTGGTCATGAAAGTGATCCGAACTCCAAAGAAG
ATGATGATGTTGCATTTGAACTCAATGAGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan