ESTScan Details for Unigene SGN-U293669

Score 
172
Direction 
Forward
Predicted Peptide Sequence 
LDASRMHSNIEIAEVALKHLVKIERGNPAHYVVLSSLYSQSGRWNDAVHTRVKMNEIGLRKNPGCSWVEVKXGNIKFCASAIEIAIGITX
LLTWADGGNPTGEESPXILQVTYIFKVDLQYLQNMASYKLHASTYXIVGSTTDHMAPTVGGKQNMLHNITSSVPFYVMSDX
Predicted Coding Sequence 
TTGGATGCATCTAGAATGCATTCTAATATTGAGATAGCAGAAGTTGCTTTGAAGCATCTTGTCAAAATTGAGCGAGGAAATCCAGCTCAT
TATGTGGTATTATCAAGTTTATATTCTCAATCTGGTAGGTGGAATGATGCAGTTCATACTAGAGTAAAAATGAATGAAATTGGGTTGAGA
AAGAATCCAGGCTGTAGTTGGGTTGAGGTGAAGXTAGGGAACATTAAATTTTGTGCAAGTGCAATAGAGATTGCCATTGGTATTACTXCT
TTGTTGACCTGGGCTGATGGTGGCAATCCAACTGGTGAAGAATCTCCAXTGATTTTACAGGTTACTTATATCTTCAAGGTTGATCTCCAA
TATCTGCAAAATATGGCAAGCTACAAGCTCCACGCCTCCACCTATAAXATTGTAGGATCTACAACTGATCATATGGCTCCTACAGTTGGX
GGGAAGCAGAACATGCTTCATAACATTACTTCCTCTGTCCCATTTTATGTGATGTCTGACTXX\
Edits in Original Sequence 
(5')TTGGATGCATCTAGAATGCATTCTAATATTGAGATAGCAGAAGTTGCTTTGAAGCATCTTGTCAAAATTGAGCGAGGAAATCCAGC
TCATTATGTGGTATTATCAAGTTTATATTCTCAATCTGGTAGGTGGAATGATGCAGTTCATACTAGAGTAAAAATGAATGAAATTGGGTT
GAGAAAGAATCCAGGCTGTAGTTGGGTTGAGGTGAAGXTAGGGAACATTAAATTTTGTGCAAGTGCAATAGAGATTGCCATTGGTATTAC
TXCTTTGTTGACCTGGGCTGATGGTGGCAATCCAACTGGTGAAGAATCTCCAXTGATTTTACAGGTTACTTATATCTTCAAGGTTGATCT
CCAATATCTGCAAAATATGGCAAGCTACAAGCTCCACGCCTCCACCTATAAXATTGTAGGATCTACAACTGATCATATGGCTCCTACAGT
TGGXGGGAAGCAGAACATGCTTCATAACATTACTTCCTCTGTCCCATTTTATGTGATGTCTGACTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan