ESTScan Details for Unigene SGN-U293809

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
MANSSNKETAIRLREVAEGAVKAIGLGFDIVDDLRLKFCKDYQLISVDDDQVRDISIPGGILVQNVPKSINCDKGERMRFSSDLLSFSKM
SERFNQELSLSGKIPTGHFNAAFEYTTCWQKD
Predicted Coding Sequence 
ATGGCGAATAGTAGTAACAAAGAAACGGCGATTAGGCTTAGAGAGGTTGCGGAAGGAGCAGTGAAGGCGATTGGGTTAGGGTTTGATATA
GTGGATGATTTGAGGTTGAAGTTTTGCAAGGATTATCAGTTGATCTCTGTTGACGATGATCAGGTGCGAGACATATCTATTCCTGGCGGA
ATTTTGGTTCAAAATGTTCCCAAATCTATCAATTGCGATAAAGGCGAACGCATGAGATTTAGTTCTGATCTTCTCTCTTTCTCCAAGATG
TCCGAGCGATTTAATCAAGAACTATCCCTTTCTGGTAAGATTCCAACGGGCCATTTCAATGCTGCTTTTGAATATACCACTTGTTGGCAA
AAAGAT\
Edits in Original Sequence 
GTCCCAACTCCCTTCACCTCCCCTGATCTTCTCTTCACCTAATCAAACCCAAAAACCCCAAGACTTTTTCTTCTTCTTGTTCTTGTTCTT
GTTCTTATCAATTAACACTTCATATTAGTATATTAATCAGTCAAATTTCATACCCGCCGTTTCTCCGGTTGCCGTACAGTGAAATTCATC
ACCGAAATACATCAACGATAATTGCTTTTACAGTTGTTAAACCATTAATTTCTTTCTAAGCGGTTTAACGAATTTGTTTCTTTAAATTTC
ATTTATATAAATATATTT
(5')ATGGCGAATAGTAGTAACAAAGAAACGGCGATTAGGCTTAGAGAGGTTGCGGAAGGAGCAGTGAAGGC
GATTGGGTTAGGGTTTGATATAGTGGATGATTTGAGGTTGAAGTTTTGCAAGGATTATCAGTTGATCTCTGTTGACGATGATCAGGTGCG
AGACATATCTATTCCTGGCGGAATTTTGGTTCAAAATGTTCCCAAATCTATCAATTGCGATAAAGGCGAACGCATGAGATTTAGTTCTGA
TCTTCTCTCTTTCTCCAAGATGTCCGAGCGATTTAATCAAGAACTATCCCTTTCTGGTAAGATTCCAACGGGCCATTTCAATGCTGCTTT
TGAATATACCACTTGTTGGCAAAAAGAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan