ESTScan Details for Unigene SGN-U293853

Score 
631
Direction 
Forward
Predicted Peptide Sequence 
NPQPSIVWASSSSVYGLNSKVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSITGLRFFTVYGPWGXPDMAYFFFTKDILRGKEI
KIFETSDHGSVARDFTYVDDVVKGCLAALDTAKKSTGSGGKKKGAAQLRIYNLGNTKPVPVGRLVSILEKLLKVKAKKKVIQMPRNGDVP
FTHANITLAHTELGYKPTTDLEMGLKKFVKWYVSYYGSRRRRVLGEVLKLGVALFLSNVPAR
Predicted Coding Sequence 
XXTAATCCACAACCTAGTATTGTTTGGGCTTCGTCAAGTTCTGTTTATGGATTGAATTCAAAAGTACCCTTTTCAGAAAAAGATAGAACT
GATCAGCCTGCTAGTTTGTATGCAGCCACTAAAAAGGCTGGTGAAGAAATTGCTCATACATATAACCATATATATGGTCTTTCGATTACT
GGATTGCGGTTTTTCACAGTATATGGACCATGGGGTAXGCCTGATATGGCTTATTTTTTCTTTACAAAAGATATTTTGAGAGGGAAGGAA
ATCAAGATTTTTGAGACATCTGATCATGGTAGTGTTGCTAGGGATTTTACTTATGTTGATGATGTGGTAAAGGGTTGTTTGGCAGCACTG
GATACCGCGAAAAAGAGCACAGGGAGTGGGGGAAAGAAGAAGGGTGCAGCCCAATTGAGGATTTATAATTTAGGTAACACAAAGCCGGTG
CCTGTTGGGAGACTTGTTAGTATTTTGGAGAAGTTGTTGAAGGTGAAAGCAAAGAAGAAGGTTATCCAAATGCCGAGGAATGGGGATGTG
CCATTTACACATGCTAATATCACTTTGGCACATACGGAGCTGGGATATAAGCCCACTACTGATTTGGAAATGGGGTTAAAGAAGTTTGTG
AAGTGGTATGTTAGCTACTATGGTTCAAGAAGAAGAAGAGTTCTTGGTGAAGTTCTTAAACTTGGTGTTGCGTTGTTTCTCTCTAATGTT
CCTGCGCGTTGA\
Edits in Original Sequence 
(5')XXTAATCCACAACCTAGTATTGTTTGGGCTTCGTCAAGTTCTGTTTATGGATTGAATTCAAAAGTACCCTTTTCAGAAAAAGATAG
AACTGATCAGCCTGCTAGTTTGTATGCAGCCACTAAAAAGGCTGGTGAAGAAATTGCTCATACATATAACCATATATATGGTCTTTCGAT
TACTGGATTGCGGTTTTTCACAGTATATGGACCATGGGGTAXGCCTGATATGGCTTATTTTTTCTTTACAAAAGATATTTTGAGAGGGAA
GGAAATCAAGATTTTTGAGACATCTGATCATGGTAGTGTTGCTAGGGATTTTACTTATGTTGATGATGTGGTAAAGGGTTGTTTGGCAGC
ACTGGATACCGCGAAAAAGAGCACAGGGAGTGGGGGAAAGAAGAAGGGTGCAGCCCAATTGAGGATTTATAATTTAGGTAACACAAAGCC
GGTGCCTGTTGGGAGACTTGTTAGTATTTTGGAGAAGTTGTTGAAGGTGAAAGCAAAGAAGAAGGTTATCCAAATGCCGAGGAATGGGGA
TGTGCCATTTACACATGCTAATATCACTTTGGCACATACGGAGCTGGGATATAAGCCCACTACTGATTTGGAAATGGGGTTAAAGAAGTT
TGTGAAGTGGTATGTTAGCTACTATGGTTCgAAGAAGAAGAAGAGTTCTTGGTGAAGTTCTTAAACTTGGTGTTGCGTTGTTTCTCTCTA
ATGTTCCTGCGCGTTGA\(3')TGATACTCTTCATTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan