ESTScan Details for Unigene SGN-U293999

Score 
377
Direction 
Forward
Predicted Peptide Sequence 
GYPGPLEKXAAEIVEALANLSLLNGVNTSKIMESGKSLVDSMLQPCLPEWTAGEPLTDRVINAMWLYLMTYRLADEEKIDETSIWYVMDE
LGSALRHSDKPNFEVSPFLYMPEGNLASAVSYSILWPIDDVREGDECTRDYLFGIGEEKQRSARLTAWFHTPKNYFIKEYEIYKNTLQPI
KIAAQYRGHQLQVVCVVVMEEVFTVCTADIX
Predicted Coding Sequence 
XGTGGATATCCAGGGCCTTTAGAGAAAGXTGCTGCTGAAATTGTTGAAGCCCTGGCTAATCTTTCTCTACTAAATGGAGTAAACACATCG
AAAATAATGGAGTCGGGGAAGTCTCTGGTTGATTCAATGCTGCAACCATGTCTTCCTGAATGGACTGCTGGAGAACCTCTAACAGATCGT
GTCATTAATGCTATGTGGTTGTACTTAATGACGTATAGACTTGCCGATGAAGAAAAGATTGACGAAACCTCTATATGGTATGTAATGGAT
GAACTTGGTTCTGCTTTGCGCCACAGCGACAAGCCAAACTTTGAAGTATCTCCTTTTCTCTACATGCCAGAGGGCAATTTGGCATCAGCT
GTGAGTTATTCAATTCTTTGGCCGATTGATGATGTTCGAGAAGGTGATGAGTGCACTCGTGATTACCTATTTGGTATCGGGGAAGAGAAG
CAACGATCTGCTCGCCTAACTGCTTGGTTCCATACACCAAAAAATTATTTTATCAAAGAATATGAAATATACAAGAACACATTGCAACCA
ATCAAAATTGCTGCCCAGTACAGGGGTCATCAATTACAAGTAGTCTGTGTTGTGGTGATGGAAGAAGTTTTTACAGTGTGTACGGCTGAC
ATACXX\
Edits in Original Sequence 
(5')XGTGGATATCCAGGGCCTTTAGAGAAAGXTGCTGCTGAAATTGTTGAAGCCCTGGCTAATCTTTCTCTACTAAATGGAGTAAACAC
ATCGAAAATAATGGAGTCGGGGAAGTCTCTGGTTGATTCAATGCTGCAACCATGTCTTCCTGAATGGACTGCTGGAGAACCTCTAACAGA
TCGTGTCATTAATGCTATGTGGTTGTACTTAATGACGTATAGACTTGCCGATGAAGAAAAGATTGACGAAACCTCTATATGGTATGTAAT
GGATGAACTTGGTTCTGCTTTGCGCCACAGCGACAAGCCAAACTTTaGAAGTATCTCCTTTTCTCTACATGCCAGAGGGCAATTTGGCAT
CAGCTGTGAGTTATTCAATTCTTTGGCCGATTGATGATGTTCGAGAAGGTGATGAGTGCACTCGTGATTACCTATTTGGTATCGGGGAAG
AGAAGCAACGATCTGCTCGCCTAACTGCTTGGTTCCATACACCAAAAAATTATTTTATCAAAGAATATGAAATATACAAGAACACATTGC
AACCAATCAAAATTGCTaGCCCAGTACAGGGGTCATCAATTACAAGTAGTCTGTGTTGTGGTGATGGAAGAAGTTTTTACAGTGTGTACG
GCTGACATACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan