ESTScan Details for Unigene SGN-U294305

Score 
281
Direction 
Forward
Predicted Peptide Sequence 
GFIVPRPRMPNGGDGTTGVALLPGPCXGLVASQFGDIQTKLVDEETVEQFLRRYFGFRHDFLPVVAGVLFAYVVVFAFTFAFAIKAFNFQ
RR
Predicted Coding Sequence 
XCAGGATTCATCGTTCCACGACCTCGTATGCCTAATGGTGGAGATGGTACTACTGGTGTTGCCCTGTTGCCTGGACCTTGTXATGGTTTG
GTTGCATCACAATTCGGAGACATCCAAACTAAACTAGTTGATGAAGAAACCGTGGAGCAATTCTTGAGACGTTACTTTGGATTCAGACAC
GATTTTCTTCCAGTCGTTGCTGGTGTGCTCTTTGCATACGTAGTTGTTTTTGCCTTCACATTTGCTTTTGCTATCAAGGCATTCAATTTC
CAGAGGAGATAA\
Edits in Original Sequence 
(5')XCAGGATTCATCGTTCCACGACCTCGTATGCCTAtATGGTGGAGATGGTACTACTGGTGTTGCCCTGTTGCCTGGACCTTGTXATG
GTTTGGTTGCATCACAATTCGGAGACATCCAAACTAAACTAGTTGATGAAGAAACCGTGGAGCAATTCTTGAGACGTTACTTTGGATTCA
GACACGATTTTCTTCCAGTCGTTGCTGGTGTGCTCTTTGCATACGTAGTTGTTTTTGCCTTCACATTTGCTTTTGCTATCAAGGCATTCA
ATTTCCAGAGGAGATAA\(3')GTGAAATCTAACCAAATGAAGAACTTTTGAAGAAACAGTGGGTACAAAATTAGTATATAGGGATTGGT
AACTACTTAAGAAAGTTCATATTTTCAACTTTTTGATGATTACTAGGTATAATTTCTTGTAATATTCATTTGAACTCTTATGTTTATTTG
TCAATGTACAATGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan