ESTScan Details for Unigene SGN-U294360

Score 
245
Direction 
Forward
Predicted Peptide Sequence 
HGQFVFTQSMCKLYVKLHGIAFDANKSASRLWGDFYFDPDTRSFKNKPPASGVERSFVQFVLEPLYKIYSQVIGEHMKSVEATLAXTWGA
LSNAAYRLNVMPLLRLACSAVFGTATGFTDMLVHHX
Predicted Coding Sequence 
CATGGGCAGTTTGTATTCACTCAATCCATGTGCAAACTGTATGTTAAGCTTCACGGAATTGCATTTGATGCCAACAAGTCTGCTTCTCGG
CTTTGGGGGGACTTCTACTTTGATCCTGATACAAGAAGTTTCAAGAACAAACCGCCTGCAAGTGGGGTTGAAAGATCTTTTGTTCAGTTT
GTTCTTGAACCTCTTTACAAAATCTATAGCCAAGTGATCGGAGAGCACATGAAGAGTGTTGAAGCAACCCTAGCAXTAACTTGGGGTGCA
CTAAGCAATGCAGCTTACCGTCTAAATGTAATGCCTCTGCTGAGGCTGGCTTGCAGTGCTGTATTTGGAACTGCCACTGGGTTTACTGAC
ATGTTGGTTCATCACAXX\
Edits in Original Sequence 
(5')CATGGGCAGTTTGTATTCACTCAATCCATGTGCAAACTGTATGTTAAGCTTCACGGAATTGCATTTGATGCCAACAAGTCTGCTTC
TCGGCTTTGGGGGGACTTCTACTTTGATCCTGATACAAGAAGTTTCAAGAACAAACCGCCTGCAAGTGGGGTTGAAAGATCTTTTGTTCA
GTTTGTTCTTGAACCTCTTTACAAAATCTATAGCCAAGTGATCGGAGAGCACATGAAGAGTGTTGAAGCAACCCTAGCAXTAACTTGGGG
TGaCACTAAGCAATGCAGCTTACCGTCTAAATGTAATGCCTCTGCTGAGGCTGGCTTGCAGTGCTGTATTTGGAACTGCCACTGGGTTTA
CTGACATGTTGGTTCATCACAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan