Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U294397

Score 
191
Direction 
Reverse
Predicted Peptide Sequence 
WEHLSNEKAVEIVKSHPRIRKCKEACQAALHVAADDKRDADMSDLXKQLTKREYGFNSFEMAMEARHAAVGFKNLEMGAHFRILQGSVPA
KSTIWRLVGKADPGSALSLTXLEEQWPTAPNSLEAVALGSRSLNQYTDSNRFSIYIRKVGAASNLTCYIYTIFGPVDIHPFLLLTASFCS
H
Predicted Coding Sequence 
XXATGGGAGCACTTGAGCAATGAAAAGGCCGTTGAAATTGTGAAGAGTCACCCTCGTATAAGGAAGTGCAAAGAGGCTTGTCAAGCTGCT
CTCCATGTAGCTGCCGACGATAAGAGAGATGCXGATATGTCTGATCTTCXGAAACAGTTGACAAAAAGAGAATATGGTTTCAATTCATTT
GAAATGGCAATGGAGGCTAGGCATGCXGCCGTTGGTTTCAAGAACTTGGAGATGGGGGCTCATTTTCGTATCTTGCAAGGAAGTGTTCCT
GCCAAAAGCACCATTTGGAGATTGGTAGGCAAGGCTGATCCAGGAAGTGCCTTGAGTTTAACTAXGCTGGAGGAGCAATGGCCAACTGCA
CCTAACTCTCTTGAAGCAGTAGCGTTAGGTTCACGTTCTCTTAATCAATACACTGATTCTAATAGATTTTCXATATACATACGCAAGGTC
GGAGCTGCAAGCAATCTGACCTGTTACATATACACTATATTCGGCCCTGTTGACATACATCCTTTTCTTTTGCTTACAGCATCTTTCTGC
TCTCATTAA\
Edits in Original Sequence 
(5')XXATGGGAGCACTTGAGCAATGAAAAGGCCGTTGAAATTGTGAAGAGTCACCCTCGTATAAGGAAGTGCAAAGAGGCTTGTCAAGC
TGCTCTCCATGTAGCTGCCGACGATAAGAGAGATGCXGATATGTCTGATCTTCXGAAACAGTTGACAAAAAGAGAATATGGTTTCAATTC
ATTTGAAATGGCAATGGAGGCTAGGCATGCXGCCGTTGGTTTCAAGAACTTGGAGATGGGGGCTCATTTTCGTATCTTGCAAGGAAGTGT
TCCTGCCAAAAGCACCATTTGGAGATTGGTAGGCAAGGCTaGATCCAGGAAGTGCCTTGAGTTTAACTAXGCTGGAGGAGCAATGGCCAA
CTGCACCTAACTCTCTTGAAGCAGTAGCGTTAGGTTCACGTTCTCTTAATCAATACACTGATTCTAATAGATTTTCXATATACATACGCA
AGGTCGGAGCTGCAAGCAATCTGACCTGTTACATATACACTATATTCGGCCCTGTTGACATACATCCTTTTCTTTTGCTTACAGCATCTT
TCTGCTCTCATTAA\(3')TTTATAATCACTTGTTCTTCCCGATTTGGATGGCTAACAGTAACAATGGGAAGTATTAATTATAGAATAAA
CTTCTTCTTGACTAGCTATATACCAAATCTCGTGAGATTGAATGAAGTATGAAAACCGAAAGTGCAATTTTCTATATACCACAGACTTAC
ACTCGAGAATAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan