ESTScan Details for Unigene SGN-U294427

Score 
167
Direction 
Forward
Predicted Peptide Sequence 
LSSDFIFSNPEEAYLSMENLPCGYRPNVGICLINHDHLVFVASRLNVPGAWQMPQGGIEDGEDPKSAAIRELREETGITSAEIIAEVRLT
EKFSLVRCICLDYVMLKINSPLTAKINPARNMKPRCPKARMIRSFIYNGCFILSGPTMVDDDFPPAVKAKVNRLWGGEWHGQAQKWFLMQ
STNAESEINLATGEAEAEFSEWKWARPXKQVIETLYTTRRPTYEEVVGLFSLTSMMVA
Predicted Coding Sequence 
CTCAGTTCTGACTTTATTTTCTCAAACCCAGAAGAAGCATATTTATCAATGGAGAATCTCCCTTGTGGTTATCGTCCTAACGTAGGAATT
TGTCTCATCAATCATGATCATTTGGTCTTTGTGGCTTCCAGATTGAATGTACCCGGAGCATGGCAAATGCCACAGGGGGGCATTGAAGAT
GGAGAAGACCCTAAATCTGCTGCCATTAGGGAATTGCGAGAGGAAACTGGAATAACATCAGCTGAAATAATTGCAGAGGTCCGTCTAACT
GAAAAGTTTTCATTAGTTAGATGTATATGTCTAGATTATGTCATGTTAAAAATTAATTCCCCTCTGACCGCAAAGATTAATCCGGCAAGA
AACATGAAACCTCGGTGTCCAAAAGCTCGAATGATCAGATCATTTATTTATAATGGTTGTTTCATATTGTCAGGTCCCACAATGGTTGAC
GATGACTTCCCACCAGCCGTAAAGGCCAAAGTAAACCGTCTTTGGGGAGGAGAATGGCATGGACAGGCACAGAAATGGTTTCTTATGCAA
TCTACCAATGCTGAAAGTGAAATCAACTTAGCAACTGGTGAAGCAGAAGCAGAATTCTCAGAGTGGAAGTGGGCAAGACCAGXNAAGCAA
GTAATTGAGACGCTGTACACTACAAGGAGGCCAACATATGAGGAAGTTGTCGGACTTTTCAGTCTTACCTCAATGATGGTAGCX\
Edits in Original Sequence 
(5')CTCAGTTCTGACTTTATTTTCTCAAACCCAGAAGAAGCATATTTATCAATGGAGAATCTCCCTTGTGGTTATCGTCCTAACGTAGG
AATTTGTCTCATCAATCATGATCATTTGGTCTTTGTGGCTTCCAGATTGAATGTACCCGGAGCATGGCAAATGCCACAGGGGGGCATTGA
AGATGGAGAAGACCCTAAATCTGCTGCCATTAGGGAATTGCGAGAGGAAACTGGAATAACATCAGCTGAAATAATTGCAGAGGTCCGTCT
AACgTGAAAAGTTTTCATTAGTTAGATGTATATGTCTAGATTATGTCATGTTAAAAATTAATTCCCCTCTGACCGCAAAGtATTAATCCG
GCAAGAAACATGAAACCTCGGTGTCCAAAAGCTCGAATGATCAGATCATTTATTTATAATGGTTGTTTCATATTGTCAGGTCCCACAATG
GTTGACGtATGACTTCCCACCAGCCGTAAAGGCCAAAGTAAACCGTCTTTGGGGAGGAGAATGGCATGGACAGGCACAGAAATGGTTTCT
TATGCAATCTACCAATGCTGAAAGTGAAATCAACTTAGCAACTGGTGAAGCAGAAGCAGAATTCTCAGAGTGGAAGTGGGCAAGACCAGX
NAAGCAAGTAATTGAGcACGCTGTACACTACAAGGAGGCCAACATATGAGGAAGTTGTCGGACTTTTCAGTCTTACCTCAATGATGGTAG
CX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan