ESTScan Details for Unigene SGN-U294568

Score 
611
Direction 
Forward
Predicted Peptide Sequence 
ENFEVSAFIMSAGATNQLISVSPPELKFQFELDKQSYCDLKVTNSTDQCVAFKVKTTSPKKYFVRPNTGIIQPWDSGFIRVTLQAQKEYP
ADMQCKDKFLLQSAIVNNDTDELPPDTFNKDGGRTVEECKLRVVYMSSHSSPGPYEDVFRQSSDFTSNQALQRIKDERDAAXPTNTTADP
GSGNDEETKKPDDPGFSLRFAIVVGVIGPNGWLSAEIVVFTFSRIACIREAVYIIPLWVRPSAALLKRGMLCETGLPFFX
Predicted Coding Sequence 
GAAAATTTTGAGGTTTCAGCTTTCATCATGAGTGCTGGTGCTACCAACCAGTTGATATCTGTTAGTCCTCCGGAGCTCAAATTCCAATTT
GAGTTGGACAAACAAAGCTACTGTGATCTTAAAGTCACAAACAGCACAGATCAATGTGTTGCTTTTAAGGTGAAAACTACTTCTCCAAAG
AAGTACTTTGTCCGACCAAACACTGGTATTATACAGCCTTGGGATTCAGGTTTCATTCGAGTCACTCTTCAAGCTCAAAAGGAGTACCCA
GCAGATATGCAATGCAAGGACAAATTCCTCCTACAGAGCGCAATTGTGAATAATGATACTGATGAACTTCCTCCAGATACTTTTAATAAG
GATGGTGGAAGAACTGTAGAAGAGTGCAAGCTTAGGGTTGTTTACATGTCTTCTCATTCCTCTCCTGGACCTTATGAAGATGTATTTCGA
CAAAGTTCTGATTTCACTTCAAATCAAGCGTTGCAGCGTATCAAAGATGAAAGGGATGCAGCTGXTCCGACAAACACAACAGCTGATCCA
GGATCTGGAAATGATGAAGAGACGAAGAAGCCGGATGACCCAGGCTTCTCTCTGAGGTTTGCAATTGTTGTGGGAGTCATTGGXCCTAAT
GGTTGGCTTTCTGCTGAAATTGTTGTCTTCACCTTCAGTAGAATAGCTTGCATTAGGGAAGCTGTCTACATCATACCCCTTTGGGTACGT
CCCTCGGCGGCXCTGCTTAAACGTGGAATGCTTTGTGAAACCGGGCTGCCCTTTTTTAXX\
Edits in Original Sequence 
(5')GAAAATTTTGAGGTTTCAGCTTTCATCATGAGTGCTGGTGCTACCAACCAGTTGATATCTGTTAGTCCTCCGGAGCTCAAATTCCA
ATTTGAGTTGGACAAACAAAGCTACTGTGATCTTAAAGTCACAAACAGCACAGATCAATGTGTTGCTTTTAAGGTGAAAACTACTTCTCC
AAAGAAGTACTTTGTCCGACCAAACACTGGTATTATACAGCCTTGGGATTCAGGTTTCATTCGAGTCACTCTTCAAGCTCAAAAGGAGTA
CCCAGCAGATATGCAATGCAAGGACAAATTCCTCCTACAGAGCGCAATTGTGAATAATGATACTGATGAACTTCCTCCAGATACTTTTAA
TAAGGATGGTGGAAGAACTGTAGAAGAGTGCAAGCTTAGGGTTGTTTACATGTCTTCTCATTCCTCTCCTGGACCTTATGAAGATGTATT
TCGACAAAGTTCTGATTTCACTTCAAATCAAGCGTTGCAGCGTATCAAAGATGAAAGGGATGCAGCTGXTCCGACAAACACAACAGCTGA
TCCAGGATCTGGAAATGATGAAGAGACGAAGAAGCCGGaATGACCCAGGCTTCTCTCTGAGGTTTGCAATTGTTGTGGGAGTCATTGGXC
CTAATGGTTGGCTTTCTGCTGAAATTGTTGTCTTCACCTTCAGTAGAATAGCTTGCATTAGGGtAAGCTGTCTACATCATACCCCTTTGG
GTACGTCCCTCGGCGGCXCTGCTTAAACGTGGAATGCTTTGTGAAACCGGGCTGCCCTTTTTTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan