Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U294595

Score 
600
Direction 
Forward
Predicted Peptide Sequence 
RPRISDVGFKILVLSIILSPNVNSPTTPNFVETDRLALLGFKDHIFKDTTDFLSSMDTVKISCGGGWEGVECDVSTGRVNRLVLQTPSER
DISVYMKGTLSSSLGDLVFLETLIISGMKHIAGAXTGKFFETFKIEAVDLGXGNSLQGDIPSGLSHLESLQTLSLSGNHLTGHVPSVLGN
FKNLQQLSLTDNMLTGVIPIGFTESC
Predicted Coding Sequence 
XXTCGGCCGAGGATTTCTGATGTTGGTTTCAAGATTCTTGTTCTTTCCATCATTCTTTCACCAAATGTCAATAGCCCAACAACCCCAAAT
TTTGTTGAAACTGATAGACTTGCTCTTCTTGGCTTCAAAGATCACATTTTTAAGGATACTACTGATTTTCTGTCATCAATGGACACGGTA
AAGATTAGTTGTGGAGGAGGTTGGGAAGGTGTAGAATGTGATGTTTCAACAGGGAGAGTGAATAGATTGGTGTTACAAACACCTTCTGAG
AGAGACATTAGTGTTTACATGAAGGGTACTTTGTCATCATCTCTTGGTGATTTGGTTTTCTTGGAGACATTGATTATAAGTGGAATGAAA
CATATTGCTGGTGCTXATACCGGAAAGTTTTTCGAAACTTTCAAGATTGAAGCAGTTGATCTTGGAXTAGGTAATTCACTACAAGGAGAT
ATACCTTCTGGTTTATCTCATTTGGAATCACTTCAAACACTTTCACTTAGTGGTAATCATTTGACAGGACATGTACCTTCTGTATTAGGA
AATTTCAAGAATCTGCAGCAGTTGAGTTTAACAGACAATATGCTAACTGGGGTTATCCCAATTGGTTTCACAGAATCTTGTTAA\
Edits in Original Sequence 
(5')XXTCGGCCGAGGATTTCTGATGTTGGTTTCAAGATTCTTGTTCaTTTCCATCATTCTTTCACCAAATGTCAATAGCCCAACAACCC
CAAATTTgTGTTGAAACTGATAGACTTGCTCTTCTTGGCTTCAAAGATCACATTTTTAAGGATACTACTGATTTTCTGTCATCAATGGAC
ACGGTAAAGATTAGTTGTGGAGGAGGTTGGGAAGGTGTAGAATGTGATGTTTCAACAGGGAGAGTGAATAGATTGGTGTTACAAACACCT
TCTGAGAGAGACATTAGTGTTTACATGAAGGGTACTTTGTCATCATCTCTTGGTGATTTGGTTTTCTTGGAGACATTGATTATAAGTGGA
ATGAAACATATTGCTGGTGCTXATACCGGAAAGTTTTTCGAAACTTTCAAGATTGAAGCAGTTGATCTTGGAXTAGGTAATTCACTACAA
GGAGATATACCTTCTGGTTTATCTCATTTGGAATCACTTCAAACACTTTCACTTAGTGGTAATCATTTGACAGGACATGTACCTTCTGTA
TTAGGAAATTTCAAGAATCTGCAGCAGTTGAGTTTAACAGACAATATGCTAACTGGGGTTATCCCAATTGGTTTCACAGAATCTTGTTAA
\(3')CTTGCAGTCCTTGGATCTGAGCCACAAATTTACTATCCGGGGGTTGTTCCAAATTTTCTTGGAGAGCTTCAAAATTTGACCATAT
ATTGATCTTTCAGTAATGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan