ESTScan Details for Unigene SGN-U294728

Score 
408
Direction 
Forward
Predicted Peptide Sequence 
NXLDLQTASILANNGFDAFHIASKQGHLEVLKELLHSFPNLVMTTDSANSTALHTAAAQGHLDVVNLLLEIDSNLAKIARNNGKTILHTA
ARMGHLEIVRALLSKDPEIGFRTDTKGQSALHMAVKGQNFDIVLELIKPNPAVLALEDNKGNRALHVADYKGEATDGX
Predicted Coding Sequence 
AACATXTTAGACCTTCAGACAGCTTCTATTCTGGCAAATAATGGTTTTGATGCATTCCATATTGCCTCAAAGCAGGGTCATCTTGAGGTA
CTGAAAGAACTGTTGCATTCATTTCCAAACCTAGTCATGACAACGGATTCAGCCAACTCTACAGCCTTACATACAGCAGCTGCTCAGGGA
CACCTTGATGTAGTAAATCTCCTTCTGGAGATCGATTCAAACCTTGCCAAGATAGCTCGTAACAATGGCAAGACTATTCTCCATACAGCT
GCAAGAATGGGGCACTTGGAAATAGTTAGAGCTCTTCTAAGCAAGGATCCTGAGATTGGCTTTAGAACAGATACAAAAGGCCAAAGTGCC
TTGCACATGGCTGTAAAGGGACAAAATTTTGATATTGTTCTTGAATTAATCAAGCCAAATCCTGCTGTATTGGCTTTGGAAGATAACAAA
GGAAACAGAGCACTTCATGTTGCXGACTACAAAGGGGAGGCCACAGATGGTAXX\
Edits in Original Sequence 
(5')AACATXTTAGACCTTCAGACAGCTTCTATTCTGGCAAATAATGGTTTTGATGCATTCCATATTGCCTCAAAGCAGGGTCATCTTGA
GGTACTGAAAGAACTGTTGCATTCATTTCCAAACCTAGTCATGACAACGGATTCAGCCAACTCTACAGCCTTACATACAGCAGCTGCTCA
GGGACACCTTGATGTAGTAAATCTCCTTCTGGAGATCGATTCAAACCTTGCCAAGATAGCTCGTAACAATGGCAAGACTATTCTCCATAC
AGCTGCAAGAATGGGGCACTTGGAAATAGTTAGAGCTCTTCTAAGCAAGGATCCTGAGATTGGCTTTAGAACAGATACAAAAGGCCAAAG
TGCCTTGCACATGGCTGTAAAGGGACAAAATTTTGATATTGTTCTTGAATTAATCAAGCCAAATCCTGCTGTATTGGCTTTGGAAGATAA
CAAAGGAAACAGAGCACTTCATGTTGCXGACTACAAAGGGGAGGCCACAGATGGTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan