ESTScan Details for Unigene SGN-U294998

Score 
237
Direction 
Reverse
Predicted Peptide Sequence 
PFKSGAFLSGAPVQPVILRYPYQRLSPAWDSISGARHVILLLCQFVNYMEATWLPVYYPSQQEKDDPRLYAENVRRLMAHEGNLLLSDIG
LAEKRVYHAALNGNNSMPTVFHQKDDDNFIAXGTEKISNPSVMLVVLFLNIMTVRLSSIV
Predicted Coding Sequence 
XXTCCATTCAAGAGTGGCGCATTTCTCTCAGGAGCTCCAGTGCAACCTGTGATACTAAGATATCCATACCAGAGATTAAGTCCTGCATGG
GACTCTATATCGGGGGCTCGGCATGTGATTCTCCTTCTCTGTCAATTTGTAAATTATATGGAGGCAACCTGGTTACCTGTTTACTACCCT
TCTCAGCAAGAAAAGGATGACCCTAGACTTTATGCTGAGAATGTTCGGAGGTTGATGGCTCATGAGGGTAATTTGTTACTTTCAGATATT
GGTTTGGCAGAGAAGCGAGTATATCATGCTGCTCTCAATGGTAATAATAGCATGCCTACTGTTTTCCATCAGAAAGACGATGATAATTTC
ATCGCCXTGGGCACTGAAAAGATATCTAATCCAAGTGTGATGCTAGTTGTGTTGTTTCTGAATATAATGACAGTGCGGTTGTCCTCTATT
GTCTAA\
Edits in Original Sequence 
(5')XXTCCATTCAAGAGTGGCGCATTTCTCTCAGGAGCTCCAGTGCAACCTGTGATACTAAGATATCCATACCAGAGATTAAGTCCTGC
ATGGGACTCTATATCGGGGGCTCGGCATGTGATTCTCCTTCTCTGTCAATTTGTAAATTATATGGAGGCAACCTGGTTACCTGTTTACTA
CCCTTCTCAGCAAGAAAAGGATGACCCTAGACTTTATGCTGAGAATGTTCGGAGGTTGATGGCTCATGAGGGTAATTTGTTACTTTCAGA
TATTGGTTTGGCAGAGAAGCGAGTATATCATGCTGCTCTCAATGGTAATAATAGCATGCCTACTGTTTTCCATCAGAAAGACGAtTGATA
ATTTCATCGCCXTGGGCACTGAAAAGATATCTAATCCAAGTGTGATGCTAGTTGTGTTGTTTCTGAATATAATGACAGTGCGGTTGTCCT
CTATTGTCTAA\(3')AATAATAAAATTTGGGTGTACTGTCTTTGTTGATATCCTGGGTGGACATTTGTTGTTCAGGTTTCCAGTTTGAG
CGGTTGTATGTGTTGTATATCATGTGTTACATGACAATTAGGCAATGTTTTAACAAACATCTTTGGACATTTGTTTATCTGAAGAATCTC
TTTGGGTTCCTGCAAAAAAAAGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan