ESTScan Details for Unigene SGN-U295029

Score 
60
Direction 
Forward
Predicted Peptide Sequence 
QDYDVTFNTHPGKANVVADALSRKTVSMGSLACLSITKRPLAKEIXDVRAKFMHLDISESGGVLASIEXDSLQYEEEPSAILDRDVGKLR
TKEIKSVKVQWKYRPVEEATRETERDRDKNFPNYSSIQTKNKRNESGKGRIKFLRVSRLFQGR
Predicted Coding Sequence 
CAAGATTATGATGTGACATTCAATACCCATCCGGGCAAAGCTAATGTGGTGGCAGATGCTTTGAGTCGAAAAACGGTGAGTATGGGTAGT
TTAGCTTGCTTAAGTATAACCAAACGACCTTTGGCTAAAGAAATTXTAGACGTTAGAGCTAAATTCATGCATTTGGACATCTCAGAAAGT
GGTGGGGTGTTAGCCAGCATTGAAGXTGATAGCCTCCAATATGAGGAGGAACCAAGTGCAATTCTTGATCGTGATGTGGGCAAGTTGAGG
ACCAAGGAGATTAAGTCCGTGAAAGTTCAATGGAAGTATCGTCCAGTTGAGGAAGCTACTAGGGAGACCGAGAGGGACAGAGACAAAAAT
TTCCCCAATTATTCGTCGATTCAGACCAAGAACAAGCGAAATGAATCTGGAAAGGGAAGGATCAAGTTTCTTAGGGTTTCAAGATTGTTT
CAAGGTAGGTGA\
Edits in Original Sequence 
(5')CAAGATTATGATGTGACATTCAATACCCATCCGGGCAAAGCTAATGTGGTGGCAGATGCTTTGAGTCGAAAAACGGTGAGTATGGG
TAGTTTAGCTTGCTTAAGTATAACCAAACGACCTTTGGCTAAAGAAATTXTAGACGTTAGAGtCTAAATTCATGCATTTGGACATCTCAG
AAAGTGGTGGGGTGTTAGCCAGCATTGAAGXTGATAGCCTCCAATATGAGGAGGAACCAAGTGCAATTCTTGATCGTGATGTGGGCAAGT
TGAGGACCAAGGAGATTAAGTCCGTGAAAGTTCAATGGAAGTATCGTCCAGTTGAGGAAGCTACTAGGGAGACCGAGAGGGACAtGAGAC
AAAAATTTCCCCAATTATTCGTCGATTCAGACCAAGAACAAGCGAAATGAATCTGGAAAGGGAAGGATCAAGTTTCTTAGGGTTTCAAGA
TTGTTTCAAGGTAGGTGA\(3')TGGTTGTGATTCTATGATTGTGTGATGTATGTTTGTTCTTGCTTCATTATGATACTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan