ESTScan Details for Unigene SGN-U295169

Score 
403
Direction 
Reverse
Predicted Peptide Sequence 
QFYRAPLTANLRTNVGTRISKIAFNSTVEIVVQDTNLLSVESHPFHLHGYNFFVVGTGIGNFDPKKDPAKYNLIDPIERNTVGVPTGGWT
AIRFRADNPGVWFFHCHLELHTGWGLKTAFLVEDGPGSDHNVLPPPKDLPTANFTRLSVFNLLHAPKLRKQRLQGSYKFRKEFXAVINFH
I
Predicted Coding Sequence 
XTTCAATTTTACAGGGCACCACTTACAGCCAACCTAAGGACAAATGTAGGCACTAGGATCAGTAAAATTGCTTTCAATTCCACTGTTGAA
ATAGTAGTCCAAGACACCAACTTATTGTCGGTGGAATCACATCCTTTCCATCTCCATGGCTATAACTTCTTTGTAGTTGGAACTGGCATC
GGAAACTTTGACCCCAAAAAAGATCCAGCAAAATACAACTTGATCGATCCTATAGAAAGAAATACTGTTGGTGTTCCTACTGGCGGTTGG
ACTGCTATTCGATTCAGGGCTGATAATCCAGGGGTCTGGTTTTTCCACTGTCATCTGGAGTTGCATACAGGCTGGGGACTGAAAACAGCA
TTTTTAGTGGAAGATGGACCAGGATCAGATCATAATGTTCTGCCTCCACCAAAGGATCTTCCAACTGCTAATTTCACAAGGCTTTCTGTT
TTCAATTTGCTTCATGCACCAAAGCTAAGGAAGCAAAGGCTTCAAGGATCATACAAATTTAGAAAGGAATTTGAXGCTGTCATAAACTTC
CACATATAA\
Edits in Original Sequence 
(5')XTTCAATTTTACAGGGCACCACTTACAGCCAACCTAAGGACAAATGTAGGCACTAGGATCAGTAAAATTGCTTTCAATTCCACTGT
TGAAATAGTAGTCCAAGACACCAACTTATTGTCGGTGGAATCACATCCTTTCCATCTCCATGGCTATAACTTCTTTGTAGTTGGAACTGG
CATCGGAAACTTTGACCCCAAAAAAGATCCAGCAAAATACAACTTGATCGATCCTATAGAAAGAAATACTGTTGGTGTTCCTACTGGCGG
TTGGACTGCTATTCGATTCAGGGCTGATAATCCAGGGGTCTGGTTTTTCCACTGTCATCTGGAGTTGCATACAGGCTGGGGACTGAAAAC
AGCATTTTTAGTGGAAGATGGACCAGGATCAGATCATAATGTTCTGCCTCCACCAAAGGATCTTCCAAcCTGCTAATTTCACAAGGCTTT
CTGTTTTCAATTTGCTTCATGCACCAtAAGCTAAGGAAGCAAAGGCTTCAAGGATCATACAAATTTAGAAAGGAATTTGAXGCTGTCATA
AACTTCCACATATAA\(3')AAATGTGGTTTTGGATTGTGTTTTTTCTTTTGTTGTCAAATTGAATTGTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan