ESTScan Details for Unigene SGN-U295547

Score 
339
Direction 
Forward
Predicted Peptide Sequence 
NFQNEFMKPFVIVMRKSSAXGDQRINHQMRLSNGFVSSQSCEIRMEEHVHGLTTAAYDDHKNIVLLAFEIMEKIVRDYFPYITETETTTF
TDCVNCLVAFTNSRFNKDISLNAIAFLRLCAAKLAEGDLGSSRNKDRETSVKVSPSSPHKGKDHNIENGELTDKEDHLYFWFPLLAGLSE
LSFDPRPEIRKSALQVLFDTLRNYGHHFSLSLWE
Predicted Coding Sequence 
XXTAATTTTCAGAATGAGTTTATGAAGCCTTTTGTGATTGTTATGCGCAAGAGTAGTGCTGXTGGAGATCAGAGAATTAATCATCAGATG
CGTCTCTCAAATGGTTTTGTCTCGAGTCAATCATGTGAAATCCGGATGGAAGAGCATGTTCATGGTCTCACCACTGCTGCTTATGATGAC
CATAAAAACATTGTGTTATTAGCTTTCGAGATAATGGAAAAGATTGTGCGAGACTATTTTCCATATATAACGGAGACTGAGACCACCACA
TTCACAGACTGTGTTAATTGCCTTGTTGCATTCACTAATAGTAGATTCAACAAAGATATTAGTCTCAATGCCATTGCTTTCCTTCGTTTA
TGTGCGGCAAAACTTGCTGAAGGTGATCTTGGCTCCTCAAGGAACAAGGACAGAGAAACTTCTGTGAAGGTTTCACCATCTTCACCTCAT
AAAGGAAAAGACCACAACATTGAAAATGGAGAATTGACAGATAAGGAGGATCATCTTTATTTCTGGTTTCCACTGTTGGCTGGACTATCT
GAACTTAGCTTCGACCCGAGGCCTGAAATCAGAAAGAGCGCTCTGCAAGTGCTGTTTGATACCTTACGCAATTACGGGCACCATTTCTCT
CTATCATTATGGGAA\
Edits in Original Sequence 
(5')XXTAATTTTCAGAATGAGTTTATGAAGCCTTTTGTGATTGTTATGCGCAAGAGTAGTGCTGXTGGAGATCAGAGAATTAATCATCA
GATGCGTCTCTCAAATGGTTTTGTCTCGAGTCAATCATGTGAAATCCGGATGGAAGAGCATGTTCATGGTCtTCACCACTGCTGCTTATG
ATGACCATAAAAACATTGTGTTATTAGCTTTCGAGATAATGGAAAAGATTGTGCGAGACTATTTTCCATATATAACGGAGACTGAGACCA
CCACATTCACAGACTGTGTTAATTGCCTTGTTGCATTCACTAATAGTAGATTCAACAAAGATATTAGTCTCAATGCCATTGCTTTCCTTC
GTTTATGTGCGGCAAAACTTGCTGAAGGTGATCTTGGCTCCTCAAGGAACAAGGACAGAGAAACTTCTGTGAAGGTTTCACCATCTTCAC
CTCATAAAGGAAAAGACCACAACATTGAAAATGGAGAATTGACAGATAAGGAGGATCATCTTTATTTCTGGTTTCCACTGTTGGCTGGAC
TATCTGAACTTAGCTTCGACCCGAGGCCTGAAATCAGAAAGAGCGCTCTGCAAGTGCTGTTTGATACCTTACGCAATTACGGGCACCATT
TCTCTCTATCATTATGGGAA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan