ESTScan Details for Unigene SGN-U295645

Score 
224
Direction 
Forward
Predicted Peptide Sequence 
EEKKEEKKESEEEKGKEEDDKTTIDIKKNEYMHQRDYIFMEYANYPPQIFSDENPNAALSCNLFGYXSGGTRNSDKEISLHVVLLLFDF
Predicted Coding Sequence 
GAAGAGAAAAAAGAAGAAAAGAAAGAAAGTGAAGAAGAAAAAGGCAAAGAGGAAGATGATAAGACAACAATAGATATCAAGAAAAATGAA
TATATGCATCAAAGGGACTACATTTTTATGGAGTATGCCAATTACCCCCCTCAGATTTTCAGTGATGAGAATCCTAATGCTGCTCTATCA
TGTAACCTTTTCGGTTACXTCAGTGGCGGAACTAGGAATTCTGACAAGGAAATTTCATTGCATGTAGTGTTGTTATTGTTCGATTTTTGA
\
Edits in Original Sequence 
(5')GAAGAGAAAAAAGAAGAAAAGAAAGAAAGTGAAGAAGAAAAAGGCAAAGAGGAAGATGATAAGACAACAATAGATATCAAGAAAAA
TGAATATATGCATCAAAGGGACTACATTTTTATGGAGTATGCCAATTACCCCCCTCAGATTTTCAGTGATGAGAATCCTAATGCtTGCTC
TATCATGTAACCTTTTCGGTTACXTCAGTGGCGGAACTAGGAATTCTGACAAGGAAATTTCATTGCATGTAGTGTTGTTATTGTTCGATT
TTTGA\(3')TATGTTCTAGTCTAGTATATGCTAATAAAGATTTATTAAATTGTCTATTTGAGAGATTTTTCTCAACATCTATCTAATAA
TTTTGGTGTTTTGGTGCTATAAGTTGTTGAACAAGATGTACATACTTTGAAAGTTTTAAACTTTTGTGCTTATGATATTAATGTCTATCC
CTCCCTATTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan