ESTScan Details for Unigene SGN-U295814

Score 
353
Direction 
Forward
Predicted Peptide Sequence 
KHATELLDCATTDVRKAYCNCLIDICVNLNQLERACELLDVGLTLNIYTDIMSRTATQWSLHLKSLSLGAALTALHIWVSDLNKALESGE
EFPSLLGINTGHGKHKYSEKGLAGVFESHLKELNAPFHEAPDKAGWFLTTKVAATSWLESRRAQEVVAASNGXGFFALWP
Predicted Coding Sequence 
AAACATGCTACTGAACTTTTGGATTGTGCAACTACGGATGTCCGGAAAGCTTACTGTAACTGTTTGATTGACATCTGTGTCAATCTTAAC
CAGTTGGAGAGAGCTTGTGAGTTGTTAGATGTTGGGCTAACTCTCAACATCTATACGGATATTATGTCTCGAACTGCTACTCAATGGTCT
TTACATTTGAAGAGCCTCTCACTTGGGGCAGCTTTAACAGCATTGCACATCTGGGTTAGTGACTTGAACAAAGCACTTGAAAGTGGGGAA
GAGTTCCCATCATTGCTTGGAATCAACACAGGACATGGAAAACATAAATATTCCGAGAAAGGTCTGGCAGGTGTATTTGAGTCGCACCTT
AAGGAATTAAACGCTCCATTCCATGAGGCACCTGATAAGGCTGGGTGGTTTTTGACTACAAAGGTTGCAGCTACATCATGGTTAGAGTCT
AGACGTGCTCAAGAGGTGGTTGCTGCTAGCAATGGTCAXGGGTTCTTTGCTCTCTGGCCTTGA\
Edits in Original Sequence 
(5')AAACATGCTACTGAACTTTTGGATTGTGCAACTACGGATGTCCGGAAAGCTTACTGTAACTGTTTGATTGACATCTGTGTCAATCT
TAACCAGTTGGAGAGAGCTTGTGAGTTGTTAGATGTTGGGCTAACTCTCAACATCTATACGGATATTATGTCTCGAACTGCTACTCAATG
GTCTTTACATTTGAAGAGCCTCTCACTTGGGGCAGCTTTAACAGCATTGCACATCTGGGTTAGTGACTTGAACAAAGCACTTGAAAGTGG
GGAAGAGTTCCCATCATTGCTTGGAATCAACACAGGACATGGAAAACATAAATATTCCGAGAAAGGTCTGGCAGGTGTATTTGAGTCGCA
CCTTAAGGAATTAAACGCTCCATTCCATGAGGCACCTGATAAGGCTGGGTGGTTTTTGACTACAAAGGTTGCAGCTACATCATGGTTAGA
GTCTAGACGTGCTCAAGAGGTGGTTGCTGCtTAGCAATGGTCAXGGGTTCTTTGCTCTCTGGCCTTGA\(3')TAATTCTTGTGCTACAG
AGATTTTGTTTCTCTTACATCTGAAAGGTACCTTTAGTAGATTATCCATTGTTTAGGATACCTCTTGTTTCTAATGGGGGAGGGTTTGAT
TTTTTGAGTTCAGTAGCTATTCCAAGTGTATCTTTTTGCAATCAGCAATAGAAAAAGAATTTGAGGGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan