ESTScan Details for Unigene SGN-U295926

Score 
417
Direction 
Forward
Predicted Peptide Sequence 
MDWVRGETVGHGSFGKVSFGDSEKPEYSVFSINGVKSSSASWSATLMNEKIILDELKGCPQIINCVGDSYSYENGEKLYNVLLEYACGGA
LSDKLKNSGDQRLPEFEVRKYTKGLLRGIHYIHKNGYVHCDIKLPNILLSENGQVKIADXRIGKESGHQKNDDKLRCELRGTPLYMSPEM
VIGGEQDTPADIWALWAVWWGNMATGKSSVEDVXDIX
Predicted Coding Sequence 
ATGGATTGGGTTAGAGGTGAAACAGTAGGCCATGGAAGCTTTGGCAAAGTGAGTTTTGGCGATTCCGAGAAACCAGAGTACTCTGTTTTC
TCCATCAATGGTGTTAAGTCTTCTTCCGCTTCCTGGTCAGCTACTTTGATGAACGAGAAGATAATCTTGGATGAACTTAAGGGGTGCCCA
CAAATTATCAATTGCGTTGGTGACAGCTACAGTTATGAAAATGGCGAAAAACTATACAATGTCTTATTGGAGTATGCTTGTGGGGGTGCT
TTGTCGGATAAATTAAAGAATTCCGGTGATCAGAGGTTGCCGGAGTTTGAAGTCAGGAAGTACACAAAGGGGTTACTCAGAGGGATTCAT
TATATCCACAAGAATGGTTATGTTCACTGCGACATTAAGCTTCCAAACATTCTTTTAAGCGAAAATGGTCAAGTCAAAATTGCTGATXTT
CGGATTGGCAAAGAGAGCGGACATCAAAAGAACGATGATAAATTGAGATGTGAATTGAGGGGTACTCCGCTGTACATGTCACCGGAAATG
GTGATCGGAGGCGAACAGGATACTCCGGCTGATATCTGGGCACTTTGGGCTGTGTGGTGGGGGAACATGGCAACTGGTAAATCCAGTGTG
GAAGATGTTCXAGATATAAXX\
Edits in Original Sequence 
AGAAACTTAAATTACCAAATTTTCAGCTCAATAAACTTCAGTTTAATTAAACACAAAA(5')ATGGATTGGGTTAGAGGTGAAACAGTAG
GCCATGGAAGCTTTGGCAAAGTGAGTTTTGGCGATTCCGAGAAACCAGAGTACTCTGTTTTCTCCATCAATGGTgGTTAAGTCTTCTTCC
GCTTCCTGGTCAGCTACTTTGATGAACGAGAAGATAATCTTGGATGAACTTAAGGGGTGCCCACAAATTATCAATTGCGTTGGTGACAGC
TACAGTTATGAAAATGGCGAAAAACTATACAATGTCTTATTGGAGTATGCTTGTGGGGGTGCTTTGTCGGATAAATTAAAGAATTCCGGT
GATCAGAGGTTGCCGGAGTTTGAAGTCAGGAAGTACACAAAGGGGTTACTCAGAGGGATTCATTATATCCACAAGAATGGTTATGTTCAC
TGCGACATTAAGCTTCCAAACATTCTTTTAAGCGAAAATGGTCAAGTCAAAATTGCTGATXTTCGGATTGGCAAAGAGAGCGGACATCAA
AAGAACGATGATAAATTGAGATGTGAATTGAGGGGTACTCCGCTGTACATGTCACCGGAAATGGTGATCGGAGGCGAACAGGATACTCCG
GCTGATATCTGGGCACTTTGGGCTGTGTGGTGGGGGAACATGGCAACTGGTAAATCCAGTGTGGAAGATGTTCXAGATATAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan