ESTScan Details for Unigene SGN-U296145

Score 
609
Direction 
Forward
Predicted Peptide Sequence 
GKMASLVATLLVVLVSLSLASESSANYQYSSPPPPKKPYQPSAPKEPYYPPTAPVKTYHAAPVYKSPPPPTPVYKSPPPPTLVYKSPPPP
VKPYHPAPVNKSPAPPDSSLQVTTSPVKPYHPASSYTSLAAAPTPIYKSSSPVKPYHPAPVYKSLTAPSPVYKSSPTLEAIPSCTRYISL
Predicted Coding Sequence 
GGGAAAATGGCCTCTCTAGTTGCTACTCTTTTAGTGGTTTTAGTGTCACTTAGCTTAGCTTCCGAAAGCTCAGCAAATTATCAATACTCA
TCTCCCCCACCACCAAAGAAGCCATACCAGCCTTCAGCACCCAAGGAGCCATACTATCCTCCAACAGCACCAGTGAAGACATACCATGCT
GCACCAGTATACAAGTCTCCACCACCACCTACTCCAGTTTACAAGTCACCACCACCCCCAACACTTGTTTACAAGTCACCACCACCACCA
GTGAAGCCATACCATCCTGCACCAGTGAATAAGTCTCCAGCACCACCGGACTCCAGTTTACAAGTCACCACATCACCAGTGAAGCCATAT
CATCCTGCATCCAGTTATACAAGTCTCGCAGCAGCCCCAACTCCCATTTACAAATCATCATCACCAGTGAAGCCATACCATCCTGCACCA
GTATACAAGTCTCTAACAGCCCCAAGTCCCGTGTACAAATCATCACCAACACTTGAAGCCATACCATCCTGCACCAGGTATATAAGTCTX
\
Edits in Original Sequence 
(5')GGGAAAATGGCCTCTCTAGTTGCTACTCTTTTAGTGGTTTTAGTGTCACTTAGCTTAGCTTCCGAAAGCTCAGCAAATTATCAATA
CTCATCTCCCCCACCACCAAAGAAGCCATACCAGCCTTCAGCACaCCAAGGAGCCATACTATCCTCCAACAGCACCAGTGAAGACATACC
ATcGCTGCACCAGTATACAAGTCTCCACCACCACCTACTCCAGTTTACAAGTCACCACCACCCCCAACACTcTGTTTACAAGTCACCACC
ACCACCAGTGAAGCCATACCATCCTGCACCAGTGAtATAAGTCTCCAGCACCACCGGACTCCAGTTTACAAGTCACCACATCACCAGTGA
AGCCATATCATCCTGCATCCAGTTATACAAGTCTCGCAGCAGCCCCAACTCCCATTTACAAATCATCATCACCAGTGAAGCCATACCATC
CTGCACCAGTATACAAGTCTCTAACAGCCCCAAGTCCCGTGTACAAATCATCACCAACACTTGAAGCCATACCATCCTGCACCAGGTATA
TAAGTCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan