ESTScan Details for Unigene SGN-U296172

Score 
177
Direction 
Forward
Predicted Peptide Sequence 
EREDECGICMEVNSKIILPNCNHIMCLKCYREWRSRYSRAPFAVKPKKGELGGSVGIYGQQRCCGHDNNYKGESKKVVMYIEKLPLIVPD
NVFDTYDDTHLKVEEKWPIGYLVEIGHMQDLENGGYGIGFGDAGVRYEGVGSFSTTXVIRRNPACIIGSIYRGRSQDFELYAFNRKILG
Predicted Coding Sequence 
GAAAGGGAAGATGAATGTGGAATTTGCATGGAGGTGAACAGCAAAATTATCCTTCCCAACTGCAATCATATAATGTGCTTGAAATGCTAT
CGTGAATGGCGTTCGAGGTACAGTCGTGCCCCTTTTGCCGTGAAGCCTAAAAAGGGTGAGCTCGGGGGATCTGTGGGTATATATGGACAG
CAAAGATGCTGTGGACATGACAACAATTACAAAGGAGAATCTAAGAAGGTTGTCATGTATATAGAGAAGTTACCGTTGATCGTGCCGGAT
AATGTTTTCGACACATATGATGATACTCATCTXAAGGTAGAGGAGAAATGGCCTATTGGTTATCTTGTTGAAATTGGTCATATGCAAGAT
TTAGAAAATGGAGGTTATGGTATTGGATTTGGTGATGCTGGXGTTAGATATGAAGGTGTTGGTTCCTTTTCCACTACCXTTGTGATTAGA
AGAAATCCAGCCTGTATTATTGGGAGCATATACAGAGGGCGGAGCCAGGACTTTGAACTTTATGCGTTCAATCGTAAAATTCTAGGATAG
TAA\
Edits in Original Sequence 
(5')GAAAGGGAAGATGAATGTGGAATTTGCATGGAGGTGAACAGCAAAATTATCCTTCCCAACTGCAATCATATAATGTGCTTGAAATG
CTATCGTGAATGGCGTTCGAGGTcACAGTCGTGCCCCTTTTGCCGTGAtAGCCTAAAAAGGGTGAGCTCGGGGGATCTGTGGGTATATAT
GGACAGCAAAGATGCTGTGGACATGACAACAATTACAAAGGAGAATCTAAGAAGGTTGTCATGTATATAGAGAAGTTACCGTTGATCGTG
CCGGATAATGTTTTCGACACATATGATGATACTCATCTXAAGGTAGAGGAGAAATGGCCTATTGGTTATCTTGTTGAAATTGGTCATATG
CAAGATTTAGAAAATGGAGGTTATGGTATTGGATTTGGTGATGCTGGXGTTAGATATGAAGGTGTTGGTTCCTTTTCCACTACCXTTGTG
ATTAGAAGAAATCCAGCCTGTATTATTGGGAGCATATACAGAGGGCGGAGCCAGGACTTTGAACTTTATGCGTTCAATCGTAAAATTCTA
GGATAGTAA\(3')CATCGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan