ESTScan Details for Unigene SGN-U296269

Score 
161
Direction 
Forward
Predicted Peptide Sequence 
VKGPGAIPAFXIKTISGLLEKVPNFKPSADQETLNKLVQKYQQKGICAPGQEPILHGMLSRQLRLDSETHTCSGDGLMQERGSERSNFLL
EVCTNNNWLPNLKDGKTLFNRLCRRRRLNEALELFNALLVLYPDEVCDALHVFLEELSAKGFTSSAKILAKEILSQAVFLVTRLIAILFR
SFAIGEVF
Predicted Coding Sequence 
GTGAAAGGGCCTGGTGCCATCCCAGCATTTGXTATTAAGACCATTTCTGGTCTGTTGGAGAAAGTTCCAAATTTTAAACCATCAGCTGAT
CAAGAAACTCTAAATAAGCTTGTTCAGAAATACCAGCAAAAAGGGATCTGTGCACCAGGGCAAGAGCCAATCTTGCATGGCATGCTAAGT
AGACAATTAAGACTTGATAGTGAAACTCATACCTGCTCTGGTGATGGGCTTATGCAAGAAAGGGGATCTGAGAGGTCTAACTTCTTACTG
GAAGTTTGCACGAATAATAACTGGTTACCTAATTTGAAGGATGGAAAGACACTCTTCAATCGCCTATGCAGGCGAAGACGGCTTAATGAA
GCACTGGAGCTTTTTAATGCCTTGCTGGTGCTCTACCCTGATGAAGTATGTGATGCTCTTCATGTGTTCCTTGAAGAGCTCAGTGCTAAA
GGGTTCACAAGCTCTGCCAAGATTCTGGCAAAGGAAATCTTAAGCCAGGCTGTATTTCTAGTCACTCGGCTCATAGCCATCTTATTCAGG
AGTTTTGCAATTGGAGAAGTTTTC\
Edits in Original Sequence 
(5')GTGAAAGGGCCTGtGTGCCATCCCAGCATTTGXTATTAAGACCATTTCTGGTCTGTTGGAGAAAGTTCCAAATTTTAAACCATCAG
CtTGATCAAGAAACTCTAAATAAGCTTGTTCAGAAATACCAGCAAAAAGGGATCTGTGCACCAGGGCAAGAGCCAATCTTGCATGGCATG
CTAAGTAGACAATTAAGACTTGATAGTGAAACTCATACCTGCTCTGGTGATGGGCTTATGCAAGAAAGGGGATCTGAGAGGTCTAACTTC
TTACTGGAAGTTTGCACGAAcTAATAACTGGTTACCTAATTTGAAGGATGGAAAGACACTCTTCAATCGCCTATGCAGGCGAAGACGGCT
TAATGAAGCACTGGAGCTTTTTAATGCCTTGCTGGTGCTCTACCCTGATGAAGTATGTGATGCTCTTCATGTGTTCCTTGAAGAGCTCAG
TGCTAAAGGGTTCACAAGCTCTGCCAAGATTCTGGCAAAGGAAATCTTAAGCCAgGGCTGTATTTCTAGTCACTCGGCTCATAGCCATCT
TATTCAGGAGTTTTGCAATTGGAGAAGTTTTC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan