ESTScan Details for Unigene SGN-U296321

Score 
276
Direction 
Reverse
Predicted Peptide Sequence 
VWRPVINFARIHGDMXLEDRLRELLISLDSSRNMADKPLAPFQKRHSEFSMLEGKDRANEFKITIPHRADAYEKLKGLSGQMRDAGYVPD
TRYVLHDIDEAAKEQALMYHSERLAIAYGLISTPARTTLRIIKNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFRDGKCSCNDYW
Predicted Coding Sequence 
XTAGTATGGAGGCCCGTTATAAATTTTGCACGAATTCATGGGGATATGANNCTTGAAGATCGACTGAGGGAGCTGCTCATTAGTTTAGAT
TCTTCCAGAAATATGGCTGATAAGCCCCTTGCACCGTTTCAGAAAAGGCATTCTGAGTTTAGTATGCTTGAGGGTAAAGATAGAGCTAAT
GAGTTCAAGATCACAATTCCACATAGGGCAGATGCATATGAAAAATTGAAAGGCTTAAGCGGGCAGATGAGGGATGCCGGTTATGTACCA
GACACGAGGTATGTGCTTCATGATATTGATGAGGCTGCTAAGGAGCAAGCGCTGATGTATCATAGTGAGCGATTGGCTATTGCATATGGT
TTAATTAGTACTCCGGCAAGAACAACTCTTAGGATCATCAAGAACCTCCGTATATGTGGTGACTGTCACAACGCCATTAAGATCATGTCA
AAGATTGTTGGGCGAGAGTTGATTGTTAGAGATAACAAGCGGTTTCATCATTTCAGAGATGGTAAATGCTCCTGTAATGACTACTGGTGA
\
Edits in Original Sequence 
(5')XTAGTATGGAGGCCCGTTATAAATTTTGCACGAATTCATGGGGATATGANNCTTGAAGATCGACTGAGGGAGCTGCTCATTAGTTT
AGATTCTTCCAGAAATATGGCTGATAAGCCCCTTGCACCGTTTCAGAAAAGGCATTCTGAGTTTAGTATGCTTGAGGGTAAAGATAGAGC
TAATGAGTTCAAGATCACAATTCCACATAGGGCAGATGCATATGAAAAATTGAAAGGCTTAAGCGGGCAGATGAGGGATGCCGGTTATGT
ACCAGACACGAGGTATGTGCTTCATGATATTGATGAGGCTGCTAAGGAGCAAGCGCTGATGTATCATAGTGAGCGATTGGCTATTGCATA
TGGTTTAATTAGTACTCCGGCAAGAACAACTCTTAGGATCATCAAGAACCTCCGTATATGTGGTGACTGTCACAACGCCATTAAGATCAT
GTCAAAGATTGTTGGGCGAGAGTTGATTGTTAGAGATAACAAGCGGTTTCATCATTTCAGAGATGGTAAATGCTCCTGTAATGACTACTG
GTGA\(3')AGTCATTAGTCCATATTCAGGCTATTACTTTGATTTTTATTGTAGAATTTGTAAATCTACTAGGTGCAATACATTCTCGGG
AATCATGTTTACAGGATGATATCAGATTGTACATTAGTTATATGGTAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan